SecReT6
Protein ID: 121597981
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0927
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]939630..940895 [+]
Producthypothetical protein
NoteTssL
UniProt IDA1UX23
KEGG IDbmv:BMASAVP1_0927
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-68, Aligned region: 46..256
OmpA [PF00691], Evalue: 3.40E-17, Aligned region: 315..413
Protein Sequence: 421 a.a.     [Download]
>gi|121597981|ref|YP_990526.1| hypothetical protein BMASAVP1_0927 [Burkholderia mallei SAVP1]
MHHPDISAPAPTFDSVAATLARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPERLDRDD
IPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFH
EDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPV
SVALSPHWQPGPRNRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPA
ELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIARVPGKVTVRGY
TDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|121596444|ref|NC_008784.1|:939630-940895 Burkholderia mallei SAVP1 chromosome II, complete sequence
GTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGACGCTCGCGCGGCGCG
AGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAGGCTCGCCCGCAACCC
GCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGGCTCGATCGCGACGAC
ATTCCGCAATTGCGACTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCTGCGAACAGGCGAACA
TCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGCGATGCAGAC
GTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACGTCGTTCCAC
GAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATTCGCCGCACGAGCACA
TCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTACCGTTACGAAGCCGA
CGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCGCAGCGCGGGCCGGTG
TCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAACAGGAGCGCGCCGTTTCGCGATTTCCCCG
CGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTTCAAGTACGCGCTGTC
GACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCGCCCGCCGCGCCGGCC
GAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCAGGCACGCTCAGCGTCGAGGAAAACGCGC
GCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGGCGTGAACCCGGCGAT
GGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAGGGTGCCGGGCAAGGTGACGGTGCGCGGCTAC
ACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCGAAGAGCGCGCGACGC
AGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAAGGGCGGCGC
CGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATCACGGTCGCG
CGCTGA