SecReT6
Protein ID: 121599193
SecReT6 ID169
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_A0054
StrainBurkholderia mallei SAVP1
Repliconchromosome I [GenBank: NC_008785] [Browse all T6SS(s) in this replicon]
Location [Strand]53277..55970 [-]
ProductClpA/B type protease
NoteTssH
UniProt IDA1UZK3
KEGG IDbmv:BMASAVP1_A0054
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-44, Aligned region: 239..336
AAA_2 [PF07724], Evalue: 3.10E-44, Aligned region: 627..795
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 240..353
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 632..727
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 802..876
AAA_5 [PF07728], Evalue: 4.80E-13, Aligned region: 240..260
AAA_5 [PF07728], Evalue: 4.80E-13, Aligned region: 314..370
AAA_5 [PF07728], Evalue: 4.80E-13, Aligned region: 631..752
Clp_N [PF02861], Evalue: 4.70E-12, Aligned region: 27..74
Clp_N [PF02861], Evalue: 4.70E-12, Aligned region: 114..131
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 56..77
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 217..264
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 284..318
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 477..504
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 622..669
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 698..720
AAA_16 [PF13191], Evalue: 4.20E-10, Aligned region: 750..877
AAA_22 [PF13401], Evalue: 8.00E-07, Aligned region: 240..326
AAA_22 [PF13401], Evalue: 8.00E-07, Aligned region: 359..400
AAA_22 [PF13401], Evalue: 8.00E-07, Aligned region: 628..652
AAA_22 [PF13401], Evalue: 8.00E-07, Aligned region: 693..725
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 222..256
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 629..749
Zeta_toxin [PF06414], Evalue: 9.10E-05, Aligned region: 133..171
Zeta_toxin [PF06414], Evalue: 9.10E-05, Aligned region: 239..260
Zeta_toxin [PF06414], Evalue: 9.10E-05, Aligned region: 621..671
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 241..310
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 631..667
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 825..843
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 231..261
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 631..649
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 806..842
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 232..256
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 627..656
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 727..759
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 238..266
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 628..653
NACHT [PF05729], Evalue: 0.00082, Aligned region: 240..267
NACHT [PF05729], Evalue: 0.00082, Aligned region: 383..470
NACHT [PF05729], Evalue: 0.00082, Aligned region: 632..651
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 240..263
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 296..335
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 450..501
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 533..559
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 627..651
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 219..254
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 292..340
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 629..670
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 702..725
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 241..373
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 630..712
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 17..40
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 225..317
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 474..507
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 627..660
SRP54 [PF00448], Evalue: 0.0059, Aligned region: 240..261
SRP54 [PF00448], Evalue: 0.0059, Aligned region: 446..515
SRP54 [PF00448], Evalue: 0.0059, Aligned region: 630..661
MobB [PF03205], Evalue: 0.0097, Aligned region: 241..264
MobB [PF03205], Evalue: 0.0097, Aligned region: 630..663
Protein Sequence: 897 a.a.     [Download]
>gi|121599193|ref|YP_991406.1| ClpA/B type protease [Burkholderia mallei SAVP1]
MSTPLKTLIAKLNPVCRKATERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADL
ERELERLKTGNTRTPVFSVHLSELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSSQFAQR
MSSQFARVRVDDLKHKFDEIAAGSSEAEPRHADADVAVPDGAAASGDAPRGPSKTPALDTYTTNLTQRAR
EGKIDPVIGRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMG
LLQAGASVKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAA
TTWSEYKKYFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRVLDDAITEAVRLSHRYISG
RQLPDKAISVLDTACAKVALAHSSTPAAIDDAKKRIERIDAEIAALEREAASGAAHDARLAELREARDAD
LKALAEDAARYEEERALVTEIGALRAELDAARESSADGKPVDVDATRAKLAERVDALRARQGNQPMVPLQ
VDGHVVAEIVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALGAIAQRVRTATANLEDPNKPRGV
FMFVGPSGVGKTETALALADVLYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNP
YSVVLLDEVEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSSAVMQACLNKAPQELPDA
ETLAETLRPQLYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVL
ARCTEVDSGARNVDHILNGTLLPEIAELVLSRIADGEAIVRIAARAAETGEFEYTVE
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|121598179|ref|NC_008785.1|:c55970-53277 Burkholderia mallei SAVP1 chromosome I, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAACCCGGTGTGCCGCAAGGCCACCGAGCGCGCCG
CCAGCCACTGCTTCGCGCGCGGTCACTACGAAGTGGATCTCGAGCATCTGTTTCTCGCGCTGCTCGACGA
GTCGACCGGCGACGTGCCGCTCGTGCTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGATCTC
GAGCGCGAGCTCGAAAGACTGAAAACGGGCAACACGCGCACGCCGGTGTTTTCGGTGCATCTGAGCGAGC
TGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCAGATCGGACGGATCCGCTCGGGGCACCTGCT
GCTCGCGCTGCTGACCGGGCCGGACCTCGCGCAGTTCGCGCAGCGGATGTCGTCGCAGTTCGCGCAGCGG
ATGTCGTCGCAGTTCGCGCGCGTGCGCGTCGATGACCTGAAGCACAAGTTCGACGAGATCGCCGCGGGTT
CGAGCGAGGCCGAGCCGCGGCACGCGGACGCCGATGTCGCGGTGCCCGACGGCGCCGCCGCTTCGGGCGA
TGCGCCGCGCGGCCCGTCGAAGACGCCGGCGCTCGACACGTACACGACGAACCTCACGCAGCGCGCGCGC
GAGGGCAAGATCGACCCGGTGATCGGCCGCGATGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCC
GCCGGCAGAACAATCCGATCATGACGGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGC
GCTGCGCATCGCGGCCGACGACGTGCCGCCGCCGCTTCGCGGCGTCGCGCTGCACGTGCTGGACATGGGC
CTCCTGCAGGCGGGCGCGAGCGTGAAGGGCGAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAGGTGA
AAAAGAGCGCGCATCCGATCATTCTCTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGGCAGGC
GGGCCAGAACGATGCGGCGAACCTGCTGAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCG
ACGACGTGGAGCGAGTACAAGAAGTATTTCGAAAAGGACGCGGCGCTTGCGCGGCGCTTCCAGGTGGTGA
AGATCGAGGAGCCGAGCGAGCCGCTCGCCGCCGCGATGCTGCGCGGGATGGCGGCGCTGATGGAGCGGCA
CTTCAACGTGCGCGTTCTCGACGACGCGATCACCGAGGCGGTGCGGCTGTCGCATCGCTATATCAGCGGC
CGCCAGTTGCCGGACAAGGCGATCAGCGTGCTCGACACCGCCTGCGCGAAGGTCGCGCTCGCGCACAGCT
CGACGCCCGCGGCGATCGACGACGCGAAAAAACGCATCGAGCGGATCGACGCGGAAATCGCGGCACTCGA
GCGCGAGGCCGCGAGCGGCGCCGCGCACGATGCGCGCCTCGCCGAACTGCGCGAGGCCCGCGACGCCGAT
CTGAAGGCGCTGGCCGAGGACGCCGCGCGCTACGAGGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGC
TGCGCGCCGAGCTCGATGCCGCACGCGAGTCGTCCGCCGACGGCAAGCCCGTCGATGTCGACGCGACGCG
CGCGAAGCTTGCCGAGCGCGTCGATGCGTTGCGCGCGCGGCAGGGCAACCAGCCGATGGTGCCGTTGCAG
GTCGACGGCCACGTCGTCGCGGAGATCGTCGCGTCGTGGACGGGCATTCCGCTCGGCAGGATGGTGAAGG
ACGAGATCGAGACCGTGCTGAACCTGCGCGATCTGCTCGGCGCGCGCGTGATCGGCCAGGACCATGCGCT
CGGCGCGATCGCGCAGCGCGTGCGCACCGCGACCGCGAACCTCGAGGATCCGAACAAGCCGCGCGGCGTG
TTCATGTTCGTCGGGCCGTCGGGCGTCGGCAAGACCGAGACCGCGCTCGCGCTCGCCGACGTGCTGTACG
GCGGCGAGCGCAAGCTGATCACGATCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAA
GGGCTCGCCGCCCGGCTACGTCGGCTACGGCGAGGGCGGCGTGCTGACGGAGGCGGTGCGTCGCAATCCG
TATTCGGTCGTGTTGCTCGACGAAGTCGAGAAGGCGCATCCGGACGTGCTCGAGATGTTCTTCCAGGTGT
TCGACAAGGGCGCGATGGACGATGCCGAAGGCCGTGAGATCGACTTTCGCAACACGCTGATCATCCTGAC
CTCGAACGTCGGCTCGTCGGCGGTGATGCAGGCGTGCCTGAACAAGGCGCCGCAGGAGCTGCCCGATGCC
GAGACGCTTGCCGAGACGCTGCGCCCGCAGCTCTACAAGACCTTCAAGCCCGCGTTCCTCGGCCGGATGA
AGGTGATTCCGTACTATCCGATCTCCGACGACGTGCTCGCCGAGATCATCGAGCTGAAGCTCGAACGGAT
TCGCCGCCGGATCGAAGCGAACCACAAGGCGGCGTTCGAGTGGGACGAGTCGCTCGTCGATGCCGTGCTC
GCGCGCTGCACCGAAGTCGATTCGGGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCGG
AGATCGCCGAGCTCGTGCTGTCGCGCATCGCCGATGGCGAGGCGATCGTGCGGATCGCCGCGCGCGCGGC
CGAGACGGGCGAATTCGAGTACACGGTCGAGTAA