SecReT6
Protein ID: 121599874
SecReT6 ID169
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_A0053
StrainBurkholderia mallei SAVP1
Repliconchromosome I [GenBank: NC_008785] [Browse all T6SS(s) in this replicon]
Location [Strand]52066..53187 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1UZK2
KEGG IDbmv:BMASAVP1_A0053
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-24, Aligned region: 55..116
ImpA-rel_N [PF06812], Evalue: 3.30E-24, Aligned region: 130..145
Protein Sequence: 373 a.a.     [Download]
>gi|121599874|ref|YP_991405.1| hypothetical protein BMASAVP1_A0053 [Burkholderia mallei SAVP1]
MPTNLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQASALLRER
TKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVDLLRA
VPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTPVAFYARLLGELKAFQA
ALDALEQELDGRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLH
SEEPVPRHAHAPCAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLAS
VVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|121598179|ref|NC_008785.1|:c53187-52066 Burkholderia mallei SAVP1 chromosome I, complete sequence
ATGCCGACCAACCTCACCGAGCTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTGT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATG
GATCACCGATATCAAGGAAGCGGACTGGGGCTTCGTCGTCGAGCAAGCGAGCGCGCTGTTGCGCGAGCGC
ACGAAGGATCTGCGGCTCGCGGTATGGCTGACCGAGGCGCTCGCGATCGAGGACGGCATCGGTGGGCTCA
CGCAGGGCTACACGCTGCTCACGAGCCTCTGCCGGCAGTTCTGGGACCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAATACCGACTCGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGATCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGGCGAATGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAACACGTCGCGC
AGGCGATCCGGCGCGATCCCGAACAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCCGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGCCCGTGGCGTTCTACGCGCGGCTGCTCGGCGAGCTGAAAGCGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGACGGGCGGGCGGGCGACGCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTACGAAACCGTCTACCGGCTCGCCGAACGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGCCCGCGCCGAGCGAGCGCGCGGAGCCGAGCTTCAAGACGCCGCTTCAT
TCGGAGGAACCCGTGCCGAGACACGCACACGCGCCGTGCGCGCCCGCGCCGATCGTGATCGCCGGCATTC
AGAATCGCGCACAGGCCGTCGAGCAACTGCGCGCGGTCGCGAAATATTTCCGCGGAACCGAGCCGCACAG
CCCCGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCGGACATGCCGCTGCATCAATGGCTTGCGTCG
GTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGATAACGCGT
GA