SecReT6
Protein ID: 121600594
SecReT6 ID169
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_A0052
StrainBurkholderia mallei SAVP1
Repliconchromosome I [GenBank: NC_008785] [Browse all T6SS(s) in this replicon]
Location [Strand]50935..51867 [+]
ProductompA family protein
NoteTagL
UniProt IDA1UZK1, A1UZK1
KEGG IDbmv:BMASAVP1_A0052
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 144..177
OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 208..302
BON [PF04972], Evalue: 0.0031, Aligned region: 81..119
BON [PF04972], Evalue: 0.0031, Aligned region: 156..169
Protein Sequence: 310 a.a.     [Download]
>gi|121600594|ref|YP_991404.1| ompA family protein [Burkholderia mallei SAVP1]
MTKPRLPLLRACRFALALAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAPVAATAGAGAT
VSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQLK
QISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFET
GSATLTPQGRAILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTT
TGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|121598179|ref|NC_008785.1|:50935-51867 Burkholderia mallei SAVP1 chromosome I, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCTGCCGCTTCGCGCTCGCGCTCGCCGCGCTCGCGCTCG
GCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGCCGATCGACGCAGGCGGCGTGCCCGT
GAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGCGCGACC
GTGTCGTCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTCGCCGACGAAG
CGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGATCGA
AATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTGAAA
CAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACAACGAGG
CGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAACGGGCT
GCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTCGAAACC
GGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGAAGATGT
CGAGCCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGCGCTCAG
CCAGGCGCGCGCGGACGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTGACGACG
ACGGGCGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGGCGCGCGCGCAATCGCCGGA
TCGAATTCCGCGCGGGACAGTAA