SecReT6
Protein ID: 121601003
SecReT6 ID169
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_A0056
StrainBurkholderia mallei SAVP1
Repliconchromosome I [GenBank: NC_008785] [Browse all T6SS(s) in this replicon]
Location [Strand]57068..58906 [-]
Producthypothetical protein
NoteTssF
UniProt IDA1UZK5
KEGG IDbmv:BMASAVP1_A0056
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|121601003|ref|YP_991408.1| hypothetical protein BMASAVP1_A0056 [Burkholderia mallei SAVP1]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVDVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALA
CYVEPDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGP
CRQLTLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|121598179|ref|NC_008785.1|:c58906-57068 Burkholderia mallei SAVP1 chromosome I, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGTTACCCGAAGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTC
ACCGAAGCGCTCGTCGACGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGT
TCGGTGCGCCGCATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAG
CCGCGCGATTCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTC
GCCGATGCGCGCTACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCG
TGATCTCGATCGCGTTCGAATCGACGTCGCCGCAGCTTGATCTCGCCGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATTTGCACGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCT
TCGACGAGACCGACGCGCTGATCGACTATCCGGCCCGTTCGCATCCGGCCTATCGGCTGCTGACCGAATA
CTTCGCATTCCCGGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCGCTCGCGCGGCGCGCGGGGCCC
TGCCGGCAGCTGACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCG
ATCTGCTGAGCGCGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATTCGGGTCGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTATATTCGATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCC
GGCCGTTCTATTCGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGA
CGACGTCGCGCGCAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGC
GCGCCGCAAACCGATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCGGCTGCGCTCGCGA
CGGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTC
AATCACGTGTCGCTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGC
GCTCCGCGGTGTCGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTC
GTCGGCTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG