SecReT6
Protein ID: 121996964
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0155
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]180465..182525 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1WTD7
KEGG IDhha:Hhal_0155
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-29, Aligned region: 56..332
Phage_base_V [PF04717], Evalue: 2.40E-10, Aligned region: 135..159
Phage_base_V [PF04717], Evalue: 2.40E-10, Aligned region: 387..468
DUF2345 [PF10106], Evalue: 3.40E-07, Aligned region: 513..605
DUF2345 [PF10106], Evalue: 3.40E-07, Aligned region: 566..672
Protein Sequence: 686 a.a.     [Download]
>gi|121996964|ref|YP_001001751.1| Rhs element Vgr protein [Halorhodospira halophila SL1]
MKGSAKEGGGAHALFRVRLPGLDPDVLRVEQIVGHQALDDGDRLQVRVCGPVGDRVREWPGQLVALTLGW
GVAPRTLHGVISEVALCGGEMSSRAATLTVCSLLHPLAGSYRRRVYRRCSALHMAREVLQGALPDGVSVT
VGVERSLPERPLVVQGAADDLAFLRRVLAREGCFPVVRDAGGRPEVRIVDHLAQAELDAAALTWRPGGGP
TPTTRATVSEVSRRWTLQPGQVRVGGFDPALPDRGRPATAGTDAAEDSPMELGLHGVTAGGESAHAEWAE
AVHEASAAQRCRIEAVVATPLLPGMRVVISGHPEASLNGAYWVYRAEHEGDQAAAIHGGGGADRVDYRGR
VELLPLDPGYRPAPVPAPAIPGVAVAWVAGGDPERAEVDEAGAYRIRLFDEAEAADGVEAAPPGPPVWAV
QPSAGAQHGLHLPLLPGTRVAVAGLHGDLEQPVILGALSSQDQPGPVTDRNPHQHLLRTAAGQRLLLDDR
PGAEGAELAVGEAARLSLEGHEEAPGATLEAPNGYLELASGGEQRVRSGGDQRLDVAGAYRVEVEGSYHL
ETEDGALHWFAGDTLHLETGAGDLLHEAPDGEVALKAGRQVSLDAGSGLRLIARQGAGDWQVESGALRLE
AAGDVALVSTGGGCLQLGDGFGLRIEDSGAVYVEGRHIELSAEQLVIAADRIEEGR
 
Nucleotide Sequence: 2061 bp     [Download]
>ref|NC_008789.1|:c182525-180465 Rhs element Vgr protein [Halorhodospira halophila SL1]
ATGAAGGGGAGTGCCAAGGAAGGCGGTGGCGCGCACGCGCTGTTTCGGGTGCGTCTACCGGGATTGGACC
CGGACGTGCTGCGGGTCGAGCAGATTGTCGGTCATCAGGCACTGGATGACGGTGACCGTCTGCAGGTCCG
GGTGTGTGGCCCGGTCGGGGATCGGGTCCGGGAGTGGCCCGGGCAGCTGGTCGCGTTGACCCTGGGTTGG
GGGGTGGCGCCGCGAACACTGCACGGGGTGATCAGCGAGGTGGCCCTCTGCGGGGGGGAGATGTCCTCGC
GGGCGGCGACCCTGACCGTGTGCTCGCTGCTCCATCCCCTGGCCGGATCATACCGGCGGCGGGTCTATCG
GCGTTGTTCGGCCTTGCACATGGCCCGCGAAGTCCTCCAGGGCGCGCTGCCCGACGGGGTGTCGGTCACC
GTGGGGGTGGAGCGGTCCCTGCCGGAGCGGCCACTGGTCGTCCAGGGCGCTGCGGATGACCTGGCCTTCC
TGCGCCGGGTGTTGGCCCGGGAGGGGTGTTTCCCGGTGGTGCGGGATGCCGGTGGGCGGCCAGAGGTCCG
CATCGTCGATCATCTGGCGCAGGCCGAACTCGACGCGGCGGCGCTGACCTGGCGCCCGGGCGGTGGGCCG
ACCCCGACCACCCGGGCGACCGTCTCCGAGGTCTCCCGCCGCTGGACGCTGCAGCCGGGGCAGGTGCGGG
TCGGCGGTTTCGATCCGGCGTTGCCCGACCGCGGGCGTCCCGCCACGGCAGGCACCGACGCCGCGGAGGA
CAGTCCGATGGAGTTGGGGCTCCACGGGGTCACGGCGGGTGGTGAGTCGGCCCATGCAGAGTGGGCCGAG
GCCGTGCACGAGGCCTCCGCGGCCCAGCGCTGCCGTATCGAGGCGGTCGTGGCGACGCCGTTGCTGCCCG
GGATGCGGGTGGTCATCTCCGGGCATCCGGAGGCTTCGCTCAATGGCGCTTACTGGGTCTACCGCGCCGA
GCACGAGGGGGACCAGGCCGCGGCGATTCACGGCGGTGGTGGTGCGGATCGGGTGGACTACCGGGGGCGG
GTGGAGCTCCTGCCGCTCGACCCCGGTTACCGGCCGGCCCCGGTGCCTGCACCCGCGATCCCGGGGGTCG
CCGTGGCATGGGTCGCTGGCGGGGATCCGGAGCGCGCCGAGGTCGACGAGGCCGGGGCGTACCGGATTCG
CCTGTTCGACGAGGCCGAGGCGGCCGATGGGGTCGAGGCAGCCCCACCGGGGCCGCCGGTCTGGGCCGTC
CAGCCGAGCGCCGGTGCGCAGCACGGCCTGCACTTGCCCCTGCTGCCCGGGACGCGCGTGGCGGTGGCGG
GGTTGCACGGCGACCTGGAACAGCCAGTGATCCTGGGGGCCCTGAGCAGTCAGGATCAGCCCGGTCCCGT
GACGGACCGCAATCCCCACCAGCACCTGCTGCGGACCGCGGCCGGGCAGCGCCTGCTGCTGGACGACCGG
CCCGGGGCCGAGGGGGCGGAGCTGGCCGTGGGCGAGGCCGCGCGACTGAGTCTGGAGGGGCACGAGGAGG
CCCCCGGGGCAACGCTGGAGGCCCCCAACGGTTATCTCGAGCTGGCCAGCGGCGGAGAACAGCGCGTGCG
CAGCGGTGGCGATCAGCGGCTCGATGTGGCCGGGGCCTATCGGGTGGAGGTCGAAGGGAGCTACCACCTG
GAGACGGAGGACGGCGCGTTGCACTGGTTTGCCGGCGACACCCTGCATCTGGAGACCGGCGCGGGGGATC
TGCTGCACGAGGCGCCAGACGGGGAAGTGGCCCTGAAGGCGGGGCGTCAGGTGTCGCTGGATGCGGGATC
AGGATTGCGGTTGATCGCCCGACAGGGTGCGGGCGACTGGCAGGTTGAATCGGGCGCGCTGCGCCTGGAG
GCGGCCGGCGACGTCGCCCTGGTCAGCACCGGGGGCGGCTGTCTGCAGCTCGGCGACGGCTTCGGGCTGC
GCATCGAGGACAGTGGTGCGGTCTATGTCGAGGGGCGGCACATTGAGCTCAGCGCCGAGCAATTGGTGAT
CGCTGCCGACCGCATCGAGGAGGGGCGGTGA