SecReT6
Protein ID: 121996965
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0156
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]182522..183484 [-]
Producthypothetical protein
NoteTssG
UniProt IDA1WTD8
KEGG IDhha:Hhal_0156
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-25, Aligned region: 48..293
Protein Sequence: 320 a.a.     [Download]
>gi|121996965|ref|YP_001001752.1| hypothetical protein Hhal_0156 [Halorhodospira halophila SL1]
MATTVTAPDTAVAHVVARGPRLRLCEAVWALEHAGLTALAADEPGPGYHIEPAADWTFPAAEIRRCRQIS
ERRVAIEANVLALLGPEAPLPSYWLEAAAREDPTGERVQGLLRMLNASVYAALLAGWRAMHGPASSAPWA
QALAAFGVGSGGGLSGLDLFLARRPNRSGLCRLVQRVTGQRQVEVVDRQPVVHPLGPFPLGQGHGPRLGE
GWGLGGMVRVAGGLLGIRIGPLAPATATGLIEEERFRRLGLWLSRYLGPVPRVEVQIMAAPGRLPAWRLG
AGARLGGATWLGRRSARAVSLPLPGRSTAPTGTTATGETQ
 
Nucleotide Sequence: 963 bp     [Download]
>ref|NC_008789.1|:c183484-182522 hypothetical protein Hhal_0156 [Halorhodospira halophila SL1]
ATGGCCACGACGGTAACTGCCCCCGATACGGCCGTTGCCCACGTCGTAGCCCGGGGCCCCCGTCTGCGGC
TGTGCGAGGCCGTCTGGGCGCTCGAGCACGCCGGCCTGACGGCGCTGGCTGCGGACGAGCCGGGGCCGGG
GTACCACATCGAGCCGGCTGCGGACTGGACCTTCCCGGCCGCCGAGATCCGCCGCTGTCGGCAGATCAGC
GAGCGTCGGGTGGCGATCGAGGCCAACGTCCTGGCCCTGCTGGGGCCGGAGGCCCCGTTGCCGAGCTACT
GGCTGGAGGCGGCAGCGCGGGAGGACCCCACCGGGGAGCGGGTGCAGGGCTTGTTGCGCATGCTCAATGC
TTCGGTCTATGCGGCGCTGCTAGCGGGATGGCGGGCGATGCACGGGCCGGCGTCATCGGCTCCCTGGGCG
CAGGCCCTGGCGGCTTTCGGGGTCGGGTCGGGGGGCGGTCTGAGCGGGCTCGATCTGTTCCTTGCCCGGC
GCCCGAATCGAAGCGGCCTTTGCCGGCTGGTTCAGCGGGTCACGGGGCAGCGGCAGGTGGAGGTGGTGGA
TCGCCAGCCGGTGGTCCACCCGTTGGGGCCGTTTCCGCTGGGCCAGGGTCACGGACCCCGTCTCGGGGAA
GGTTGGGGACTGGGCGGCATGGTCCGTGTCGCCGGCGGCCTGCTGGGGATTCGTATTGGCCCGTTGGCGC
CCGCCACCGCCACCGGGCTCATCGAAGAGGAACGGTTCAGGCGCCTCGGGCTATGGCTGAGCCGTTACCT
CGGGCCCGTGCCGCGTGTTGAGGTGCAGATCATGGCCGCCCCGGGGCGGCTGCCTGCCTGGCGTCTGGGG
GCAGGCGCCCGGCTGGGTGGGGCCACGTGGCTCGGCCGGCGGTCGGCCCGAGCCGTGTCGTTGCCCCTGC
CGGGGCGGTCCACGGCGCCCACCGGGACGACAGCGACAGGAGAGACGCAATGA