SecReT6
Protein ID: 121996966
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0157
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]183469..185166 [-]
Producthypothetical protein
NoteTssF
UniProt IDA1WTD9
KEGG IDhha:Hhal_0157
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-64, Aligned region: 4..565
Protein Sequence: 565 a.a.     [Download]
>gi|121996966|ref|YP_001001753.1| hypothetical protein Hhal_0157 [Halorhodospira halophila SL1]
MDLRRAFEQEMRRLTEAGSAFARAYPGEARMLGLDDPHDRDPYVERLLEGLAFLTAGVHAELAAGIEDLH
QQLLHLAAPELAEPWPSATVLAFSLAPSRPEPVALPRGATVWSPPECADGVAIPFATLAAGTVEPIEVDR
AEWLPGPEGGSEVRMVLRFPPADAAAPSLPGVLPLLIDAEAGLWERLRAALLHGVRRVRVRCDEADPGRV
IGGGELLAPWLAETVQDGPGEPIAPALSHLRCFFLARPLLAWVQLGGLERVSLPAGADRLEVCCELDWPA
PGAAAADRRLLLSNCLPAVNLGSTDAEPQWIEAGPGPFPVRSDGDGPGRRVVHQVLGVRVRAADSGRVRA
YHPPWQPQLEAGEAGIYRVQRRDPDAGHGVAVCLDTPAGPGTLGARLRYSHGELPRRCLGRGNVTQPGAE
VPDGVTVTNLRRPTRFQPAPLERGRGQALSRLVRGDLERWATREGVQELIAGLADAPGSAAAEACHAALR
SLVCTSAVRVREGVVETGLHATLELDARPWRDPGEAYLLAECVYRVLAAWTPLDRYLELVLHLEPHGEVA
QWPRR
 
Nucleotide Sequence: 1698 bp     [Download]
>ref|NC_008789.1|:c185166-183469 hypothetical protein Hhal_0157 [Halorhodospira halophila SL1]
ATGGATCTGCGTCGGGCGTTTGAGCAGGAGATGCGGCGGTTGACCGAGGCCGGGTCGGCCTTCGCCCGCG
CCTATCCGGGCGAGGCCCGGATGTTGGGCCTGGACGATCCCCACGATCGGGACCCGTACGTGGAACGGCT
CCTCGAGGGGCTGGCCTTCCTGACCGCCGGGGTTCACGCCGAGCTCGCCGCCGGGATCGAAGACCTCCAT
CAGCAGTTGCTCCATCTGGCCGCCCCGGAGCTGGCCGAGCCCTGGCCAAGTGCCACAGTGCTGGCCTTCT
CGCTCGCCCCGTCCCGACCTGAGCCGGTGGCGTTACCCCGTGGCGCCACGGTCTGGTCGCCGCCGGAGTG
CGCAGATGGGGTGGCGATCCCGTTTGCCACCCTGGCTGCTGGCACGGTCGAGCCGATCGAGGTGGACCGG
GCCGAGTGGCTGCCGGGCCCGGAGGGCGGCAGTGAGGTGCGCATGGTGCTGCGGTTCCCGCCGGCGGATG
CCGCGGCACCGAGCCTGCCCGGGGTGTTGCCGCTGCTGATCGATGCCGAGGCGGGTCTCTGGGAGCGCCT
GCGTGCCGCGCTCCTGCACGGGGTCCGGCGGGTGCGGGTGCGCTGCGACGAGGCGGATCCCGGGCGGGTG
ATCGGTGGGGGGGAGCTGCTGGCCCCGTGGCTGGCGGAAACGGTGCAGGACGGCCCCGGAGAGCCGATTG
CGCCAGCGCTGAGCCACCTGCGGTGTTTCTTTCTGGCCCGGCCGCTGCTTGCCTGGGTTCAGCTCGGCGG
ACTGGAGCGGGTTTCGCTGCCTGCCGGGGCCGACCGCCTGGAGGTCTGTTGCGAGCTGGACTGGCCGGCG
CCGGGCGCGGCCGCGGCGGATCGGCGACTGTTGCTCAGCAACTGCCTGCCGGCGGTGAACCTCGGGTCCA
CCGATGCCGAACCGCAATGGATCGAGGCCGGGCCGGGTCCCTTCCCGGTGCGCAGCGATGGAGACGGTCC
GGGGCGCCGTGTGGTCCATCAGGTCCTCGGGGTCCGCGTGCGTGCTGCGGACAGCGGTCGGGTACGGGCT
TATCACCCGCCCTGGCAACCGCAGCTGGAAGCCGGGGAGGCTGGTATATACCGCGTGCAGCGGCGCGATC
CGGACGCGGGCCACGGCGTTGCCGTGTGCCTGGACACACCAGCGGGCCCGGGCACGCTCGGCGCGCGCCT
GCGTTACTCCCACGGCGAACTGCCGCGCCGGTGCTTGGGCCGGGGAAACGTGACGCAGCCCGGGGCCGAG
GTGCCGGACGGGGTGACGGTGACCAACCTGCGGCGGCCGACGCGCTTCCAGCCGGCCCCCCTGGAGAGGG
GGCGGGGCCAGGCCCTGTCCCGCCTGGTCCGGGGGGATCTGGAGCGGTGGGCGACCCGGGAGGGGGTGCA
GGAGCTGATTGCCGGCCTCGCCGACGCGCCGGGCAGCGCGGCGGCGGAGGCCTGTCACGCCGCGCTGAGG
TCACTGGTGTGCACCTCGGCGGTACGGGTCCGGGAGGGGGTGGTGGAGACGGGGCTGCACGCCACCCTGG
AGCTCGACGCCCGACCTTGGCGGGATCCGGGCGAGGCCTACCTCCTCGCTGAATGTGTCTATCGGGTGCT
GGCCGCCTGGACGCCGCTGGATCGTTATCTGGAGCTGGTCTTACATCTGGAGCCGCACGGGGAGGTGGCC
CAATGGCCACGACGGTAA