SecReT6
Protein ID: 121996967
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0158
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]185144..185581 [-]
Producthypothetical protein
NoteTssE
UniProt IDA1WTE0
KEGG IDhha:Hhal_0158
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-13, Aligned region: 27..116
Protein Sequence: 145 a.a.     [Download]
>gi|121996967|ref|YP_001001754.1| hypothetical protein Hhal_0158 [Halorhodospira halophila SL1]
MTVGLFDRLEGGTGRPPPHTGTMPGSESRASVVRHILRLLAARRGRPAHLAGYGLPDLSSYYHDLDGAAA
CLATAAQELIPRYEPRVVSLAVHAQPASVETGYVLWLALRAQLHRGKHLTLELAVDGNAGVHLLSGGGDG
SASGV
 
Nucleotide Sequence: 438 bp     [Download]
>ref|NC_008789.1|:c185581-185144 hypothetical protein Hhal_0158 [Halorhodospira halophila SL1]
GTGACGGTAGGGCTTTTCGATCGCCTGGAAGGGGGCACTGGTCGCCCGCCGCCGCACACCGGGACGATGC
CTGGGAGCGAGAGTCGGGCGAGCGTGGTTCGGCACATCCTCCGGTTGCTGGCAGCGCGCCGCGGACGCCC
GGCCCACCTGGCCGGCTACGGACTGCCGGACCTCTCGTCCTACTACCACGATCTGGACGGCGCCGCTGCG
TGCTTGGCGACGGCCGCTCAGGAGTTGATCCCCCGTTACGAGCCCCGGGTCGTCAGCCTGGCCGTGCACG
CGCAGCCCGCTTCGGTGGAGACGGGCTACGTGCTCTGGCTGGCGTTGCGCGCGCAGCTGCACCGGGGCAA
ACACCTGACGCTGGAGCTGGCGGTGGACGGAAACGCCGGCGTACACCTGCTCAGCGGAGGTGGGGATGGA
TCTGCGTCGGGCGTTTGA