SecReT6
Protein ID: 121996968
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0159
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]185637..186122 [-]
Producthypothetical protein
NoteTssD
UniProt IDA1WTE1
KEGG IDhha:Hhal_0159
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-37, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|121996968|ref|YP_001001755.1| hypothetical protein Hhal_0159 [Halorhodospira halophila SL1]
MAIPAYMWLKDDQGNEIEGSVTITDREGSIEVLGFEHELRIPTDSDTGALTGTRKHEPFVFTKAFDSASP
YLYKACSKGQTLEELVLSWYQIDESGNEQEYFRHTLNDVKITSVRPVMHNVKEADKERFPHMEQVAIRYG
RITWAYVDGNIEFSDSWTEGR
 
Nucleotide Sequence: 486 bp     [Download]
>ref|NC_008789.1|:c186122-185637 hypothetical protein Hhal_0159 [Halorhodospira halophila SL1]
ATGGCGATTCCTGCCTACATGTGGCTCAAGGACGATCAGGGCAACGAGATCGAGGGGTCGGTGACCATCA
CCGACCGCGAGGGCAGCATCGAGGTGCTCGGCTTCGAGCACGAGCTACGCATCCCCACGGACAGCGACAC
CGGTGCCCTGACCGGTACGCGCAAGCACGAACCGTTCGTCTTCACCAAGGCCTTCGATTCGGCCTCACCC
TACCTCTACAAGGCGTGCAGCAAGGGGCAGACGCTCGAGGAGCTGGTGCTGAGCTGGTACCAGATCGACG
AGTCGGGCAACGAGCAGGAGTACTTTCGGCACACCCTCAACGACGTGAAGATCACCTCGGTGCGCCCGGT
GATGCACAACGTCAAGGAGGCCGATAAGGAGCGCTTCCCGCACATGGAGCAGGTGGCCATCCGCTATGGC
CGGATCACTTGGGCTTACGTGGACGGGAACATCGAGTTCTCCGACTCCTGGACCGAGGGCCGGTGA