SecReT6
Protein ID: 121996969
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0160
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]186157..187671 [-]
Producthypothetical protein
NoteTssC
UniProt IDA1WTE2
KEGG IDhha:Hhal_0160
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.20E-177, Aligned region: 82..503
Protein Sequence: 504 a.a.     [Download]
>gi|121996969|ref|YP_001001756.1| hypothetical protein Hhal_0160 [Halorhodospira halophila SL1]
MSEQTSADRAAEATAPAASYAHLCQLAEVEPVSGALEIATFQDSAVMADIPSESRLTAALQVFLDLASQD
GELVERIDKALLDEYIARIDAAVSEQLDAVLHHPEFQRVESAWRSLRFLVERSDPKANIKLELLDVSKEE
LAGELEDVTDITQSGLYQHVYVQEYDTPGGEPLAAMVSNYEFDCSAADINLLTEVSRIAAAAHCPFLGAV
GRDFFGKASLDEVVRIPDIASYLDKAEYARWRGFRDTEDARYVGLTLPRFLLRLPYGADNPTRAFDYREN
VTGVDHDRYLWGNAAFAFAANMARSFKAYGWTVNIRGPESGGKLEQLPIHVFDLGRGAQTKTPTEVLISE
NREIELAEAGFIPLSFYKNSDYACFFSANSAQRPARYNSPAATANARINARLPYIFLVSRLAHYLKVLQR
ENIGSAKSRQDLENELNDWLQGLVTKMQNPDPDLVATRPLREGVVEVEEVPENPGFYRVNMSVMPHFQIE
GIDLKLSLVSQLPT
 
Nucleotide Sequence: 1515 bp     [Download]
>ref|NC_008789.1|:c187671-186157 hypothetical protein Hhal_0160 [Halorhodospira halophila SL1]
ATGAGTGAGCAGACGAGCGCAGATAGGGCCGCAGAAGCCACGGCCCCGGCGGCAAGCTATGCGCACCTGT
GCCAGCTGGCCGAGGTCGAGCCGGTCTCCGGCGCCCTGGAGATCGCCACCTTCCAGGACTCGGCGGTCAT
GGCGGACATCCCCTCGGAGAGTCGATTGACCGCTGCCCTGCAGGTGTTCCTGGATCTCGCCAGTCAGGAC
GGCGAGCTGGTCGAGCGCATCGACAAGGCGTTGCTCGACGAGTATATCGCCCGCATCGACGCGGCGGTGA
GCGAGCAGCTCGACGCCGTCCTGCACCATCCGGAGTTCCAGCGGGTGGAGTCGGCCTGGCGCAGCCTGCG
TTTCCTCGTCGAACGCAGCGATCCCAAGGCGAACATCAAGCTGGAGCTGCTCGATGTCTCCAAGGAAGAG
CTGGCCGGCGAGCTCGAGGATGTCACTGACATCACCCAGTCCGGCCTGTACCAGCACGTCTATGTGCAGG
AGTACGACACCCCGGGCGGGGAGCCCTTAGCCGCCATGGTCTCCAACTATGAGTTCGACTGCTCGGCGGC
GGACATCAACCTGCTGACCGAGGTATCCCGGATTGCGGCGGCGGCCCACTGTCCCTTCCTCGGTGCCGTC
GGCCGGGACTTCTTCGGCAAGGCCTCCCTGGATGAGGTGGTCCGGATCCCGGATATCGCCAGCTATCTAG
ATAAGGCCGAGTACGCCCGCTGGCGCGGGTTCCGCGACACCGAAGACGCTCGGTACGTCGGCCTCACCCT
GCCGCGGTTCCTGCTGCGCCTGCCCTACGGGGCCGACAACCCCACCCGTGCGTTCGACTACCGCGAGAAC
GTCACCGGGGTCGATCACGATCGCTACCTTTGGGGGAATGCAGCCTTCGCCTTTGCCGCCAACATGGCCC
GTTCCTTCAAGGCCTACGGGTGGACGGTCAATATTCGCGGGCCGGAGTCCGGCGGCAAGCTCGAGCAGCT
GCCGATCCACGTCTTCGACCTCGGCCGTGGGGCGCAGACCAAGACCCCCACCGAGGTGCTCATCTCCGAG
AACCGCGAAATCGAGCTGGCCGAGGCCGGATTCATCCCGCTGAGCTTCTACAAGAACAGCGATTACGCCT
GCTTCTTCTCGGCCAACTCGGCGCAGCGTCCGGCCCGCTACAACAGTCCCGCGGCGACGGCGAATGCCCG
GATCAACGCCCGGTTGCCGTACATCTTCCTGGTCTCCCGTCTGGCTCACTATCTCAAGGTGCTGCAGCGG
GAGAATATCGGCTCGGCCAAGAGCCGGCAGGACCTGGAAAACGAGCTCAACGATTGGCTGCAGGGGCTGG
TGACCAAGATGCAGAATCCGGATCCCGATCTGGTCGCTACCCGCCCGCTACGCGAGGGGGTGGTGGAGGT
CGAGGAGGTCCCCGAAAACCCGGGCTTCTACCGGGTCAACATGTCGGTGATGCCGCACTTCCAGATCGAG
GGTATCGACCTGAAGCTCTCGCTGGTGTCGCAGTTGCCGACCTGA