SecReT6
Protein ID: 121996970
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0161
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]187675..188277 [-]
Producthypothetical protein
NoteTssB
UniProt IDA1WTE3
KEGG IDhha:Hhal_0161
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.00E-48, Aligned region: 19..171
Protein Sequence: 200 a.a.     [Download]
>gi|121996970|ref|YP_001001757.1| hypothetical protein Hhal_0161 [Halorhodospira halophila SL1]
MAGPVESIDAKEQAMESFQQEVPKSRVNITLDVDTGDARKTLELPLKMLVLGDFSNGQASGRLAERERVP
IDRDHLDAVLGDLSPSLQVTVPDTFRGDGSQIRVALKIDGFHAFSPEAVARQIPQVNNLLAMRNLLKDLK
SNVLDNARFRRELERIVQNQKELEGVMGELRQIAPLHTGEEDREAGSSGESTEADRDGQE
 
Nucleotide Sequence: 603 bp     [Download]
>ref|NC_008789.1|:c188277-187675 hypothetical protein Hhal_0161 [Halorhodospira halophila SL1]
GTGGCGGGACCGGTGGAGTCCATCGATGCCAAGGAGCAGGCCATGGAGAGTTTCCAACAGGAAGTGCCGA
AATCACGGGTGAACATCACCCTCGATGTGGATACAGGGGACGCCCGCAAGACCCTGGAACTGCCGCTGAA
GATGCTGGTCCTGGGCGACTTCAGCAACGGCCAGGCCAGTGGCCGTCTCGCCGAACGTGAGCGCGTGCCC
ATCGACCGGGACCATCTCGACGCCGTCCTCGGCGACCTCAGTCCCTCCCTGCAGGTGACGGTGCCGGATA
CCTTCCGGGGGGACGGGTCGCAGATCCGGGTGGCCCTCAAGATCGACGGTTTCCACGCCTTCAGCCCCGA
GGCCGTGGCCCGGCAGATCCCGCAGGTCAATAACCTGCTGGCGATGCGCAATCTGCTCAAGGATCTGAAG
TCGAACGTCCTCGATAACGCCAGATTTCGGCGCGAGCTGGAGCGCATCGTGCAGAACCAGAAGGAGCTGG
AGGGGGTGATGGGCGAGCTCAGGCAGATCGCCCCGCTGCATACCGGGGAGGAGGACCGAGAGGCCGGCTC
CTCGGGCGAATCAACGGAAGCCGACCGGGATGGTCAGGAGTGA