SecReT6
Protein ID: 121996971
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0162
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]188287..189783 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA1WTE4
KEGG IDhha:Hhal_0162
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.50E-17, Aligned region: 54..115
ImpA-rel_N [PF06812], Evalue: 6.50E-17, Aligned region: 380..389
ImpA-rel_N [PF06812], Evalue: 6.50E-17, Aligned region: 421..438
Protein Sequence: 498 a.a.     [Download]
>gi|121996971|ref|YP_001001758.1| ImpA domain-containing protein [Halorhodospira halophila SL1]
MTEECHPDATDHPLGLPGRVLAALDGDADVGADPRHGERFARLREAVQRLGGADFAQVAEDAAVLLEQEA
KDLRVLGYLCLAELQERGLEGFRAALAALHGALAAFGERIHPQRDGGRRAAIEWLSERRMLALLDRAAGR
DDPEQLRALEAELDRLGAELERLWSDPPGLRPLRNWVQERQTAVAVATERTAPTQPGAREDDRSPGPPRS
GQELGRRLREALDFLRSEGEWLAMTALARAWRWGRLGPLSADDGRLRIEPPRQVALTAIRRHVDEGAWEA
AYLAAESAFLEPGGHLQLEIQAVAERSATAMGRDDIAAYIRAAAAELLQRHPALPDLRFSDGSPLVPPGQ
VAWVADRVGTGDESPWREEGETPVQLGEALALMRSEGLAAALRQIDATPQRSGRERCAQELVRARLCLDA
GYPELARARLELLAAEIERRGLDEWDPESTLAVWRELALALQASERDGQLDREQVARRLLALRHRVARAD
LEAAIAFP
 
Nucleotide Sequence: 1497 bp     [Download]
>ref|NC_008789.1|:c189783-188287 ImpA domain-containing protein [Halorhodospira halophila SL1]
GTGACCGAGGAGTGCCATCCCGATGCGACGGACCACCCGCTGGGGCTGCCGGGGCGTGTCCTTGCCGCCC
TGGACGGGGATGCGGACGTAGGCGCCGATCCACGCCACGGTGAGCGGTTCGCTCGCCTGCGCGAGGCGGT
CCAGCGGCTGGGCGGGGCGGATTTCGCCCAGGTCGCCGAGGACGCGGCGGTCCTGCTGGAGCAGGAGGCC
AAGGATCTCCGCGTGCTTGGTTACCTGTGCCTGGCCGAGCTCCAGGAGCGTGGACTCGAGGGGTTTCGCG
CGGCGCTGGCGGCACTGCACGGCGCTCTGGCCGCGTTCGGCGAGCGGATCCATCCGCAGCGGGACGGTGG
CCGGCGGGCGGCCATCGAGTGGCTGTCGGAGAGGCGCATGCTGGCCCTGCTCGATCGGGCGGCCGGCCGC
GATGATCCCGAGCAGCTGCGCGCCCTGGAAGCGGAGCTCGACCGGCTGGGCGCGGAGCTGGAGCGGTTGT
GGTCGGACCCGCCGGGGCTGCGGCCGCTGCGCAACTGGGTGCAGGAACGGCAGACCGCCGTTGCCGTGGC
CACCGAGCGGACTGCGCCTACGCAGCCCGGCGCGCGGGAGGATGACCGTTCGCCGGGTCCGCCGCGAAGT
GGCCAGGAGCTGGGACGGCGGCTGCGCGAGGCGCTGGATTTCCTGCGCAGCGAGGGCGAGTGGCTGGCGA
TGACCGCGCTGGCTCGCGCCTGGCGCTGGGGGCGGCTTGGACCGCTGAGCGCCGACGATGGTCGGCTGCG
CATCGAGCCACCGCGCCAGGTGGCGCTGACCGCGATACGAAGGCACGTCGATGAAGGCGCCTGGGAAGCG
GCCTACCTGGCCGCCGAATCGGCCTTCCTGGAGCCGGGCGGGCACCTCCAGCTGGAGATCCAGGCCGTCG
CTGAACGGTCGGCGACGGCGATGGGGCGAGACGATATCGCTGCGTACATCCGTGCGGCAGCGGCGGAGTT
GCTACAGCGCCACCCGGCGTTGCCGGATCTGCGCTTCAGTGATGGCAGCCCATTGGTCCCCCCGGGACAG
GTCGCCTGGGTGGCCGATCGCGTGGGAACGGGTGACGAATCGCCATGGCGGGAGGAGGGTGAGACCCCGG
TGCAACTCGGTGAGGCGCTGGCGTTGATGCGCAGCGAAGGACTGGCAGCCGCGCTGCGGCAAATCGATGC
CACGCCGCAGCGCAGCGGTCGCGAGCGCTGCGCCCAGGAGCTGGTTCGGGCGCGCCTCTGCCTGGATGCC
GGCTATCCCGAGCTGGCCCGGGCGCGCCTTGAGCTGCTGGCGGCGGAGATCGAACGCCGGGGGTTGGACG
AGTGGGATCCGGAATCAACGCTGGCGGTTTGGCGGGAACTGGCGCTGGCACTGCAAGCCAGCGAGCGCGA
CGGTCAGCTCGATCGCGAGCAGGTGGCTCGGCGCCTGCTCGCACTGCGCCACCGGGTGGCGCGTGCCGAT
CTGGAGGCGGCGATCGCCTTCCCCTGA