SecReT6
Protein ID: 121996973
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0164
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]193220..193933 [-]
Producthypothetical protein
NoteTssL
UniProt IDA1WTE6
KEGG IDhha:Hhal_0164
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-39, Aligned region: 17..209
Protein Sequence: 237 a.a.     [Download]
>gi|121996973|ref|YP_001001760.1| hypothetical protein Hhal_0164 [Halorhodospira halophila SL1]
MIAAEQAASPPTSTGSLLEVAEPLLREAASLRDGRIAAAQGDGLRERARQTLERLRERGLAAGLGDAALA
DAERAVVAFLDEAVIASAHPERAAWLAQPLQVERLGERASGQRFFQRLEGPREQAPPAAVLELYLACLWL
GFQGVHALEDQALLDAHRHRLGEWLADRTPAAPPPPPASAGTDRGAGQHVGWFWSAVAVLALAALAYLHT
GVQVERAAEAAAEEIEAAREVLRRGTP
 
Nucleotide Sequence: 714 bp     [Download]
>ref|NC_008789.1|:c193933-193220 hypothetical protein Hhal_0164 [Halorhodospira halophila SL1]
ATGATCGCGGCGGAGCAGGCTGCGTCGCCGCCGACGTCGACGGGGTCGCTGCTGGAGGTGGCGGAGCCGC
TGTTGCGCGAAGCAGCGTCACTGCGTGACGGCCGAATCGCTGCAGCGCAGGGAGATGGGCTGCGTGAGCG
GGCGCGGCAGACGCTGGAGCGGTTGCGGGAACGGGGCCTCGCCGCCGGCCTGGGCGATGCCGCCCTGGCC
GATGCCGAGCGGGCGGTGGTGGCGTTCCTGGACGAGGCGGTGATCGCCTCGGCGCATCCGGAGCGGGCGG
CGTGGCTGGCGCAACCGCTCCAGGTCGAGCGCCTCGGCGAACGCGCGTCGGGTCAGCGTTTCTTCCAGAG
GCTGGAGGGCCCTCGCGAGCAAGCCCCGCCGGCGGCGGTCCTTGAGCTGTACCTGGCCTGCCTGTGGCTC
GGCTTCCAGGGAGTCCACGCTCTGGAGGATCAGGCGCTGCTTGATGCGCATCGCCATCGGCTCGGCGAGT
GGCTGGCCGACCGGACGCCCGCGGCACCCCCGCCGCCCCCGGCGTCGGCGGGCACGGATCGGGGTGCCGG
TCAGCATGTGGGCTGGTTCTGGTCGGCGGTGGCGGTGCTTGCTCTCGCGGCGCTGGCCTATCTCCACACC
GGGGTGCAGGTGGAGCGGGCCGCCGAGGCTGCCGCCGAAGAGATCGAGGCTGCCCGGGAGGTGTTGCGGA
GGGGCACGCCATGA