SecReT6
Protein ID: 121996974
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0165
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]193930..195282 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1WTE7
KEGG IDhha:Hhal_0165
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.90E-100, Aligned region: 22..445
Protein Sequence: 450 a.a.     [Download]
>gi|121996974|ref|YP_001001761.1| hypothetical protein Hhal_0165 [Halorhodospira halophila SL1]
MDVTALLQRPVWAEGVLLGQQHFQCWERYLEAAQARRLSAVTPHAYGLLGLVVEEAPLEQGVLRLQACQA
LLPDGRLVAHGHGDPLELDLTGSSGQEGVVYLTLPRNNRVRDLPGYADGGSSAAWRPRFVQLADQHDEQR
EREVLLADPELALGTQPPSGARVGLPVARVVPGDAGGFRLDPAFLPVACRLDASTGWQTLLGRITARVEN
RCARLREEQGATGRVSAFEPGEVARLLLRQSLEPAACALRSLVANPASHPGQLYDILARLVAALSALSEV
TSPAETVPVYDHDRPAAVFTALEEGLERLLDQAMPRQTRGVRLVCESEAVLVTEGAEQPLMEGWTFFLAV
HGAADPAGDWIARLPMDLRVGPREALERLVAAGVAGVRLVHAPRPPGQLPVKSGYEYFRLEPAGEHWEQA
QRAGGLAVYRPAELAHLRMEMVALREEENP
 
Nucleotide Sequence: 1353 bp     [Download]
>ref|NC_008789.1|:c195282-193930 hypothetical protein Hhal_0165 [Halorhodospira halophila SL1]
ATGGACGTCACGGCATTGCTCCAACGACCGGTCTGGGCGGAAGGCGTATTGCTGGGGCAGCAGCACTTCC
AGTGCTGGGAGCGCTATCTCGAGGCGGCCCAGGCGCGTCGCCTCAGTGCGGTTACCCCTCACGCCTACGG
CCTGCTGGGCCTTGTGGTCGAAGAGGCCCCCCTGGAACAGGGCGTGCTCCGGCTTCAGGCCTGCCAGGCG
CTGCTGCCGGACGGGCGTTTGGTCGCCCATGGCCACGGTGATCCCCTGGAGCTGGATCTGACCGGCTCAT
CGGGGCAGGAAGGCGTCGTCTACCTGACGCTGCCGCGCAACAATCGCGTCCGTGATCTGCCCGGCTACGC
CGATGGGGGGAGCAGCGCAGCCTGGCGGCCGCGTTTCGTGCAGCTCGCCGATCAACACGACGAGCAGCGC
GAGCGTGAAGTCCTGCTTGCCGACCCGGAGCTGGCGCTGGGGACGCAGCCGCCATCGGGTGCCCGGGTCG
GACTGCCCGTGGCGCGTGTGGTGCCAGGCGATGCAGGTGGGTTTCGTCTCGATCCGGCGTTTTTGCCCGT
CGCCTGCCGGCTGGATGCTTCCACTGGATGGCAGACGCTGCTCGGGCGCATCACAGCCCGCGTAGAGAAC
CGCTGTGCCCGTCTGCGCGAAGAACAGGGGGCCACCGGGCGGGTCAGCGCCTTCGAACCGGGCGAGGTGG
CGCGGCTGTTGCTGCGCCAGAGCCTGGAGCCGGCGGCCTGCGCCCTGCGCTCGTTGGTCGCCAACCCCGC
CAGTCACCCCGGGCAGCTTTACGACATCCTCGCCCGCCTGGTGGCAGCGCTGTCGGCGCTCTCCGAGGTG
ACCTCGCCGGCCGAGACGGTACCGGTCTACGATCACGACCGTCCGGCTGCCGTGTTTACCGCGCTGGAGG
AGGGGCTGGAGCGCCTGCTGGATCAGGCCATGCCTCGCCAGACCCGCGGTGTCCGCCTGGTTTGCGAGTC
CGAGGCCGTGCTGGTGACCGAGGGTGCGGAGCAGCCGCTGATGGAGGGGTGGACCTTCTTCCTGGCCGTG
CACGGCGCGGCCGACCCGGCTGGCGACTGGATCGCGCGCCTGCCCATGGATCTGCGCGTCGGCCCGCGGG
AGGCCCTCGAGCGTCTGGTCGCCGCCGGGGTGGCCGGTGTGCGCCTGGTCCATGCCCCCAGGCCGCCCGG
GCAACTGCCGGTCAAGAGCGGCTACGAGTACTTCCGGTTGGAGCCGGCCGGGGAGCATTGGGAGCAGGCC
CAGCGTGCGGGGGGACTGGCCGTGTACCGACCGGCCGAACTGGCCCACCTGCGGATGGAGATGGTGGCGC
TGCGCGAGGAGGAGAACCCATGA