SecReT6
Protein ID: 121996975
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0166
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]195284..195907 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA1WTE8
KEGG IDhha:Hhal_0166
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-26, Aligned region: 53..178
Protein Sequence: 207 a.a.     [Download]
>gi|121996975|ref|YP_001001762.1| hypothetical protein Hhal_0166 [Halorhodospira halophila SL1]
MDVDRRKAVRGDRRPGRSPCAGSAPARRSLIPSVTARPLGWGVALLLCAWAAAGCTPRVELDMTAGPQLN
PGPQGEPLSVLLRVYQLDDRTPFEDADRAALTRDDRAALGGWEQRRELVLQPGERKEVELEMADPAGYLA
VAVFYLDEQAERWRLLEPLPESFLGMRPGQRITLALDGGALWAGSEAERRRAAWQREDVAGQRSAGL
 
Nucleotide Sequence: 624 bp     [Download]
>ref|NC_008789.1|:c195907-195284 hypothetical protein Hhal_0166 [Halorhodospira halophila SL1]
ATGGATGTGGACCGCAGGAAGGCGGTTCGGGGTGATCGCCGCCCCGGGCGCTCCCCGTGCGCCGGCTCCG
CCCCCGCACGACGTTCGCTGATACCCTCCGTTACGGCTCGCCCCCTTGGCTGGGGTGTGGCACTGCTCCT
GTGTGCCTGGGCGGCAGCAGGGTGTACGCCCCGGGTCGAACTCGACATGACCGCCGGGCCTCAGCTCAAC
CCTGGACCGCAGGGGGAACCGCTCTCGGTCCTCCTGCGAGTCTATCAGCTCGACGACCGCACGCCCTTCG
AAGACGCGGACCGCGCGGCACTGACCCGGGATGACCGCGCCGCGCTGGGCGGCTGGGAGCAGCGGCGCGA
GCTGGTCCTGCAACCCGGCGAGCGCAAGGAAGTCGAGCTGGAGATGGCCGACCCGGCCGGTTATCTGGCA
GTGGCCGTCTTCTACCTCGATGAGCAGGCCGAGCGCTGGCGTCTCCTGGAGCCTTTGCCGGAATCCTTCC
TGGGGATGCGCCCCGGCCAGAGGATCACCCTGGCGCTGGATGGGGGTGCGCTGTGGGCGGGCAGCGAGGC
CGAGCGCAGGCGCGCCGCCTGGCAGCGGGAGGATGTCGCCGGGCAGCGTTCGGCAGGGCTTTGA