SecReT6
Protein ID: 122879264
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3484
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3734036..3735370 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-138, Aligned region: 16..442
Protein Sequence: 444 a.a.     [Download]
>gi|122879264|ref|YP_202123.6| hypothetical protein XOO3484 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSKVFWGEGLFLRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGE
SYDAPAHDALPDALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQS
ELAYLSKAVKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAK
VDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNA
YQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVS
ADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLK
AQSMMLYVPSGIDDLKMELVAVTS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3734036-3735370 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGTCGAAAGTATTTTGGGGCGAAGGTCTGTTTTTGCGGCCGCAGCATTTCCAGCGCCAGGACACCTACC
ACGAAGCAAGGCTGCAGGATCTGGCGCAGACGCTGCATCCCTATGGCTGGGGAACGCGCCGGATCCGTTT
CGATCCGCAGAGCATGGCTAGCGGCAGCTTGCGCGCGCTCGCCCTGTCGGTGGTCTTTCCCGATGGCGAA
TCGTACGACGCGCCGGCGCACGACGCGCTGCCCGATGCGCTGTCGCTGAATGACCTCCCCGCCGGCATCC
AGACCACCACGGTGTACCTGGCGCTGCCGTTGCTGCGCGACGACGGCGGCAACTGTAGCGATGCGGAGGG
TTCGCAACTGGCCCGCTACCAGCAGCTCAACCGGCCGACCAGCGACCTGTACACCGACGCGGCCCAATCG
GAACTGGCGTACCTGAGCAAGGCGGTGAAGCTGCTCACCGACGACACTCCGCGCGATCCGTACGTGACCG
TGCCGGTGGCGCGCGTGCGCCGTACCCCGACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATG
CGCGCACATCGACGCCTCGCCGACGCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAG
GTCGATGCGCTGTACGGGCTGCATCGGCAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCG
CCTCGTTCTGGCTGCTGCATACCGCCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCA
GCTGCACCCGGAGCGCTTGTACCAGGAACTGCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCC
TACCAGCTCAACGACCTGCCCCGGTACAACCACGCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGA
TCGTGCGCGACCTGCTCGACACGGTGATCTCGGCGCGCTATTTCAAGATCGCGCTGACCGAGGTCAAGCC
GTCGTTCCACCTGGGCCGGATCGATTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCG
GCCGACATGCCCGGGCCGGAACTGGTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACG
TCGAGAAGTGCGTGCTGTCGGCCCTGCCGGGCGTGAAACTGACCCACGCCGCGCAGGTGCCGGCAGCGAT
CCCGGTCCGTCCCGGCAGCTACTATTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAG
GCGCAGTCTATGATGCTCTATGTGCCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTAACCT
CATGA

Protein ID: 58583116
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3493
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3754541..3755431 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ5GX24
KEGG IDxoo:XOO3493
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-97, Aligned region: 2..294
Protein Sequence: 296 a.a.     [Download]
>gi|58583116|ref|YP_202132.1| hypothetical protein XOO3493 [Xanthomonas oryzae pv. oryzae KACC 10331]
MKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAKVDALYGLH
RQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPR
YNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPEL
VQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYV
PSGIDDLKMELVAVTS
 
Nucleotide Sequence: 891 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3754541-3755431 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGAAGCTGCTCACCGACGACACTCCGCGCGATCCGTACGTGACCGTGCCGGTGGCGCGCGTGCGCCGTA
CTCCGACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATGCGCACACATCGACGCCTCGCCGAC
GCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAGGTCGACGCGCTGTACGGGCTGCAT
CGGCAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCGCCTCGTTCTGGCTGCTGCATACCG
CCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCAGCTGCACCCCGAGCGCCTGTACCA
GGAACTGCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCCTACCAGCTCAACGACCTGCCCCGG
TACAACCACGCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGATCGTGCGCGACCTGCTCGACACGG
TGATCTCGGCGCGCTACTTCAAGATCGCGCTGACCGAGGTCAAGCCGTCGTTCCACCTGGGCCGGATCGA
TTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCGGCCGACATGCCCGGGCCGGAACTG
GTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACGTCGAGAAGTGCGTGCTGTCGGCCC
TGCCGGGCGTGAAGCTGACCCACGCCGCGCAGGTGCCGGCAGCGATCCCGGTCCGTCCCGGCAGCTACTA
TTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAGGCGCAGTCTATGATGCTCTATGTG
CCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTGACCTCATGA