SecReT6
Protein ID: 124381226
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0714
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]750672..752519 [-]
Productsensor histidine kinase
NoteVirA
UniProt IDA2RXW0
KEGG IDbml:BMA10229_0714
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 7.60E-21, Aligned region: 455..593
MASE1 [PF05231], Evalue: 2.80E-15, Aligned region: 63..324
HisKA [PF00512], Evalue: 0.00055, Aligned region: 312..339
HisKA [PF00512], Evalue: 0.00055, Aligned region: 338..403
Protein Sequence: 615 a.a.     [Download]
>gi|124381226|ref|YP_001024529.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MHGNSIDAGPPARARPARITRTARTAPRRDDRAFAPGGALNAAGLLLLLLFYANHLLSRPGACTSLNHTL
SAVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRY
LIAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTW
NARACGAAWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALI
AMTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDF
SNVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALA
ATRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNG
GASDGASRGANDGGAPAARAFDVAIGEAAMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLG
LAIVAGAALAHRGQIAVATDRGAGSCFRLTLPAAWGTGAPGAMDAGAPGAVQERT
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c752519-750672 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAACGGCGC
GCACCGCGCCGCGCCGCGACGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTG
TCGGCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCAT
GGTGGCTCGGCGCGGGTTCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCA
CGTCGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTAT
CTGATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCA
TGGCGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTATGGATGAACGACCGCGAATGGCTGAG
CGAATGGTCGCGCGCGTATGCGGCGAACGCGCTCGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGG
AACGCGCGCGCATGCGGCGCGGCGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCT
CGCTGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAG
CTGGGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATC
GCGATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGACGGCCACGGCGTCTGGGCGCTGCAGG
TCGATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTTGC
GCGGCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTC
AGCAACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCG
CGGACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCT
CGCCGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGAGGCGCTCGCC
GCGACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCC
GGCGTGGCGACGTTCGTCACGTCGTATTCGCCGATCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGT
CGGCAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAATGGC
GGCGCGAGCGATGGGGCGAGCCGCGGCGCGAACGACGGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCG
CGATCGGCGAAGCGGCGATGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGT
CGAGCCGCTCGACCGCATCTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGT
CTCGCGATCGTCGCGGGCGCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGCGG
GCAGTTGCTTCCGGCTCACGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGC
GCCCGGCGCAGTACAGGAGAGGACATGA