SecReT6
Protein ID: 124381336
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0728
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]770621..772054 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-98, Aligned region: 28..474
Protein Sequence: 477 a.a.     [Download]
>gi|124381336|ref|YP_001024543.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTHDASRTGTNDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVE
IRSARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRY
ATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYAL
SGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHP
WTVYGVLRQLVGELSVFSECFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATF
EPDGPQQPAQRSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTR
LPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|124381141|ref|NC_008835.1|:770621-772054 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACGCACGACGCATCACGAACCGGAACGAACGACATGGACAACGTCTATTGGCATCAGGGGATGCTGC
TGCAACCGCAACATTTTCAGTTGGCCGAACTGCACCAGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGG
CCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCTCGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAG
ATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGCTACGTCGAATATCCGGGCAACGCGGTCGTCGCCG
CGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCCGCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCT
CGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGCGCCCGACGCGTTGCCCGACGCCCCGACGCGCTAC
GCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTGCATTCGGACCATCCGGGCGCGCCGGTGCGCACGC
TCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGCTCGACGCGCTCGCCGCGCACGAAACGATCCCGAT
CGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCTCGACGACGATTTCGCGCCGCCCTGCTACGCGCTG
TCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGCATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGT
TGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCGCCGAATTCGACGCGAGCTATGCGGCGTTCCTGCT
CGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCTGTTCCATCTCGCCGAATGCGACGGGCAGCATCCA
TGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGCGAGCTGAGCGTGTTCTCCGAGTGCTTCGACATGC
TCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGCCGTACGACCACCGCGATCTGGGCGGCTGCTTCTC
GCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGAAATCGCGGTGGGCCCGGACTGCGTCGCGACGTTC
GAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCGGCGCAACTGCCGCCCGACGTGTTCGCGGATCGCC
ACCAGATCTATCTCGCGATCCGCAGCGCGCACGATCCGGACACGCTCGCGCAACGCTTCGCGCTCGGCGG
CCGGATCGCGGCGACCGACGAAATGCCGCAGCTCACCGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGC
CTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGCGACGCGCGCTACTTCCGGATCGAGCAGGCCGGCC
GCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGTCGCTGCGCTGGGCCGACGCGCCCGACGACCTGCA
CGCGGAACTCGTCGCAGTGAGGCACACGCAATGA