SecReT6
Protein ID: 124381690
SecReT6 ID175
T6SS typei3
Gene symbol-
Locus tagBMA10229_1789
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1832305..1834959 [+]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDA2S0W7
KEGG IDbml:BMA10229_1789
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 229..248
AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 617..778
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 230..332
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 213..224
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 784..858
AAA_5 [PF07728], Evalue: 3.80E-12, Aligned region: 230..249
AAA_5 [PF07728], Evalue: 3.80E-12, Aligned region: 620..738
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 230..310
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 370..396
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 516..547
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 615..646
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 681..703
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 37..58
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 102..162
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 207..246
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 443..546
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 613..664
AAA_16 [PF13191], Evalue: 8.00E-09, Aligned region: 685..703
Sigma54_activat [PF00158], Evalue: 2.80E-07, Aligned region: 225..245
Sigma54_activat [PF00158], Evalue: 2.80E-07, Aligned region: 602..728
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 224..251
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 616..640
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 730..751
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 616..642
AAA_17 [PF13207], Evalue: 4.30E-05, Aligned region: 231..247
AAA_17 [PF13207], Evalue: 4.30E-05, Aligned region: 374..402
AAA_17 [PF13207], Evalue: 4.30E-05, Aligned region: 619..656
Zeta_toxin [PF06414], Evalue: 7.30E-05, Aligned region: 230..247
Zeta_toxin [PF06414], Evalue: 7.30E-05, Aligned region: 615..660
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 231..249
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 621..649
AAA_14 [PF13173], Evalue: 0.00023, Aligned region: 287..310
AAA_14 [PF13173], Evalue: 0.00023, Aligned region: 618..737
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 617..646
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 229..245
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 582..641
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 689..713
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 228..254
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 518..539
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 596..644
ResIII [PF04851], Evalue: 0.0033, Aligned region: 221..249
ResIII [PF04851], Evalue: 0.0033, Aligned region: 287..311
ResIII [PF04851], Evalue: 0.0033, Aligned region: 592..641
Hpr_kinase_C [PF07475], Evalue: 0.0045, Aligned region: 230..243
Hpr_kinase_C [PF07475], Evalue: 0.0045, Aligned region: 618..638
T2SE [PF00437], Evalue: 0.0062, Aligned region: 218..243
T2SE [PF00437], Evalue: 0.0062, Aligned region: 573..698
NACHT [PF05729], Evalue: 0.0068, Aligned region: 230..256
NACHT [PF05729], Evalue: 0.0068, Aligned region: 289..337
NACHT [PF05729], Evalue: 0.0068, Aligned region: 620..646
Arch_ATPase [PF01637], Evalue: 0.0075, Aligned region: 127..154
Arch_ATPase [PF01637], Evalue: 0.0075, Aligned region: 208..243
Arch_ATPase [PF01637], Evalue: 0.0075, Aligned region: 287..314
Arch_ATPase [PF01637], Evalue: 0.0075, Aligned region: 619..641
Sigma54_activ_2 [PF14532], Evalue: 0.0099, Aligned region: 224..246
Sigma54_activ_2 [PF14532], Evalue: 0.0099, Aligned region: 602..639
Protein Sequence: 884 a.a.     [Download]
>gi|124381690|ref|YP_001025587.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MSDIGRVTLFGKLNTFLYETLEQATGFCRLRGNPYVELAHWLNQMLRRPDSDVHRILRRFDIDAAAIDRG
IVSALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDAAQIRGAVLLLALVKTPQLRNVLYAIARDFER
IVPDVLADELERIVAGSPEAPSPAARAAAGAIGDAGAAPSAAREGSALARYAIDLTARARAGEIDPVVGR
DGEIRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKG
EFESRLRGVIDEASSSERPVILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYI
EKDPALTRRFQLVQVREPEEGAALAMLRGLAAKLEAHHRVLVLDDALQAAVTLSHRYIPARQLPDKAISL
LDTACARVAVSQYAVPAPIEDVRRRIDSLRVERELIARECALGAGDAQRLDAIDASIAGEQTTLDALDAR
WQAERDALGKIVDWRASLLADDSSRVLDEAARADVQAKLSAALRALAELQGETPLVLPAVDTHAVAAVVS
DWTGIPLGRMVRDEMQSVLKLAETLAERVVGQPHAVELIAERIQTARARLDDPAKSHGVFLLCGPSGVGK
TETALALAEMLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEK
AHRDVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTSNVGSERVMQLCRDPQRLPDAQTLTDALREVFPA
ALLGRLTVVPYYPLTDEMLARIVALQLARIERRIEAHHGIALRCADSATALIAERCRTIESGGRMVDAIL
THTVLPRISQEILRATIEGRALRAIDVSAEDGQFVYRFEEEGAT
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1832305-1834959 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGTCCGATATCGGCCGAGTGACCTTGTTTGGAAAACTGAACACTTTTCTCTACGAGACCCTGGAGCAGG
CGACCGGCTTTTGTCGGCTGCGCGGCAATCCCTATGTCGAGCTCGCGCACTGGCTGAACCAGATGCTCCG
GCGCCCGGACAGCGACGTGCACCGGATCCTGCGCCGCTTCGACATCGACGCGGCGGCGATCGACCGCGGG
ATCGTTTCGGCGCTCGACCGGCTGCCGCGCGGCGCGGGTTCCGTGTCCGATCTGTCCGCGCACATCGATG
ATGCGGTCGAACGCGCATGGGTGTACGCGACGCTCAAGTACGACGCGGCGCAGATTCGCGGCGCGGTGCT
GCTGCTCGCGCTCGTGAAGACGCCGCAGCTGCGCAACGTGCTGTACGCGATCGCGCGGGACTTCGAGCGC
ATCGTGCCTGACGTGCTTGCCGACGAGCTCGAACGGATCGTCGCAGGCTCGCCGGAGGCGCCGTCGCCCG
CCGCGCGCGCGGCGGCGGGGGCGATCGGCGACGCGGGGGCGGCGCCGTCCGCCGCGCGCGAAGGCTCGGC
GCTCGCGCGCTACGCGATCGATCTGACCGCGCGTGCGCGCGCGGGCGAGATCGATCCGGTGGTCGGCCGC
GACGGCGAGATTCGGCAGATCGTCGACATCCTGCTGCGCCGCCGGCAGAACAATCCGCTGCTCGTCGGCG
AGGCGGGCGTCGGCAAGACCGCGGTCGCCGAAGGCTTCGCGCTGCGCATCGTCGCGGGCGACGTGCCGCC
GCCGCTGCGCGACGTCGAACTGTATCTGCTCGACATCGGCCTGCTGCAGGCGGGCGCGAGCGTGAAGGGC
GAATTCGAGAGCCGCCTGCGCGGCGTGATCGACGAGGCGAGTTCGAGCGAGCGGCCCGTCATTCTGTTCA
TCGACGAGGTACACACGCTCGTCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCGAACCTGTTGAA
GCCCGCGCTCGCGCGCGGCCTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAATACAAGCAATACATC
GAGAAGGACCCGGCGCTCACGCGGCGCTTCCAGCTCGTGCAGGTGCGCGAGCCGGAGGAGGGCGCGGCGC
TGGCGATGCTGCGCGGGCTCGCCGCGAAGCTGGAGGCGCACCATCGCGTGCTCGTGCTCGACGATGCGCT
GCAGGCGGCCGTCACGCTGTCGCATCGCTACATTCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTG
CTCGACACCGCGTGCGCGCGCGTCGCGGTCAGCCAGTACGCGGTGCCCGCGCCGATCGAGGACGTGCGGC
GGCGGATCGATAGCCTGCGCGTCGAGCGCGAGCTGATCGCGCGCGAGTGCGCGCTCGGCGCGGGCGATGC
GCAACGGCTCGATGCAATCGATGCATCGATCGCCGGCGAACAGACCACGCTCGATGCGCTCGACGCGCGC
TGGCAGGCGGAGCGCGACGCGCTCGGCAAGATCGTCGACTGGCGGGCCTCGCTGCTGGCCGACGATTCTT
CGCGCGTGCTCGATGAGGCGGCGCGCGCGGACGTGCAGGCGAAGCTCTCGGCCGCGCTGCGCGCGCTCGC
CGAATTGCAGGGCGAGACGCCGCTCGTGCTGCCCGCGGTCGATACGCACGCGGTGGCCGCCGTGGTGTCC
GACTGGACCGGCATCCCGCTCGGGCGGATGGTGCGCGACGAGATGCAATCGGTGCTGAAGCTCGCCGAGA
CGCTCGCCGAGCGCGTGGTCGGCCAGCCGCACGCGGTCGAGCTGATCGCCGAGCGCATTCAGACCGCGCG
CGCGCGGCTCGACGATCCGGCCAAGTCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAG
ACCGAGACGGCGCTCGCGCTCGCCGAGATGCTGTACGGCGGCGAGCACAACGCGATCACGATCAACATGA
GCGAGTTTCAGGAGGCGCACACCGTATCGACGCTCAAGGGCGCGCCGCCCGGCTACGTCGGCTACGGACA
GGGCGGGGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGTGTCGTGCTGCTCGACGAAATCGAGAAG
GCGCACCGCGACGTGCACGAGATCTTCTTTCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGGC
GCTATATCGACTTTCGCAACACGGTGATCCTCCTCACGTCGAACGTCGGTTCCGAGCGCGTGATGCAGCT
GTGCCGCGATCCGCAGCGCCTGCCCGATGCGCAGACCTTGACCGATGCGCTGCGCGAGGTGTTTCCCGCC
GCGTTGTTGGGACGCCTGACGGTCGTTCCGTACTACCCGCTCACCGACGAGATGCTCGCGCGGATCGTCG
CATTGCAGCTCGCGCGCATCGAGCGGCGCATCGAAGCGCACCACGGCATCGCGTTGCGCTGCGCGGATTC
GGCGACCGCGCTGATCGCCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGCATGGTCGACGCGATTCTC
ACGCACACGGTGCTGCCGCGCATCAGCCAGGAGATCCTGCGCGCGACGATCGAGGGGCGCGCGCTGCGGG
CGATCGACGTGAGCGCCGAAGACGGCCAGTTCGTTTACCGATTCGAAGAGGAGGGCGCGACGTGA