SecReT6
Protein ID: 124381929
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0715
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]752779..753273 [+]
Producthypothetical protein
NoteTssB
UniProt IDA2RXW1
KEGG IDbml:BMA10229_0715
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|124381929|ref|YP_001024530.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|124381141|ref|NC_008835.1|:752779-753273 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACAACGAACGGATCCGTCGCACCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCGCGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA