SecReT6
Protein ID: 124381972
SecReT6 ID175
T6SS typei3
Gene symbol-
Locus tagBMA10229_1785
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1827905..1828396 [+]
Producthypothetical protein
NoteTssD
UniProt IDA2S0W3
KEGG IDbml:BMA10229_1785
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|124381972|ref|YP_001025583.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1827905-1828396 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCATGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGCGCAACGGCGATCATC
AAGAACTGCGCGAGCGGCAAGCACCTGCCGACGGTCGAGATATCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTGGACCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGTTTTCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAAGTGTCGGTCGGCTGGAACATCAAGGAGAACACCGAGATGT
GA