SecReT6
Protein ID: 124382088
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1037
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1085122..1087791 [-]
Productchaperone ATPase
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-35, Aligned region: 160..182
AAA_2 [PF07724], Evalue: 2.00E-35, Aligned region: 530..696
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 161..266
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 535..620
AAA_5 [PF07728], Evalue: 1.60E-11, Aligned region: 161..181
AAA_5 [PF07728], Evalue: 1.60E-11, Aligned region: 535..635
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 138..183
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 204..239
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 419..419
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 529..557
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 551..629
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 700..796
ClpB_D2-small [PF10431], Evalue: 6.70E-08, Aligned region: 702..775
ClpB_D2-small [PF10431], Evalue: 6.70E-08, Aligned region: 783..800
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 161..268
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 533..556
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 595..619
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 140..181
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 535..643
Zeta_toxin [PF06414], Evalue: 2.90E-06, Aligned region: 155..185
Zeta_toxin [PF06414], Evalue: 2.90E-06, Aligned region: 534..585
AAA_17 [PF13207], Evalue: 8.30E-06, Aligned region: 161..181
AAA_17 [PF13207], Evalue: 8.30E-06, Aligned region: 422..437
AAA_17 [PF13207], Evalue: 8.30E-06, Aligned region: 536..570
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 161..189
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 534..566
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 155..180
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 535..553
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 648..678
AAA_18 [PF13238], Evalue: 6.00E-05, Aligned region: 161..181
AAA_18 [PF13238], Evalue: 6.00E-05, Aligned region: 536..561
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 158..183
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 533..556
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 766..781
SRP54 [PF00448], Evalue: 9.40E-05, Aligned region: 161..193
SRP54 [PF00448], Evalue: 9.40E-05, Aligned region: 534..557
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 155..178
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 533..567
Torsin [PF06309], Evalue: 0.00024, Aligned region: 163..183
Torsin [PF06309], Evalue: 0.00024, Aligned region: 491..557
AAA_25 [PF13481], Evalue: 0.0003, Aligned region: 161..184
AAA_25 [PF13481], Evalue: 0.0003, Aligned region: 423..437
AAA_25 [PF13481], Evalue: 0.0003, Aligned region: 530..553
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 139..180
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 213..310
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 534..568
RNA_helicase [PF00910], Evalue: 0.0019, Aligned region: 162..182
RNA_helicase [PF00910], Evalue: 0.0019, Aligned region: 536..556
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 151..236
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 535..550
AAA_33 [PF13671], Evalue: 0.009, Aligned region: 52..83
AAA_33 [PF13671], Evalue: 0.009, Aligned region: 161..183
AAA_33 [PF13671], Evalue: 0.009, Aligned region: 534..555
AAA_33 [PF13671], Evalue: 0.009, Aligned region: 808..834
Protein Sequence: 889 a.a.     [Download]
>gi|124382088|ref|YP_001024845.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MEKALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAGKVRSGHLLLAWLDEDLTRRWLQQRVPSGIT
SVALDDVVKRYEALAAGWPEADEAPAALDGAALGAQAGEAGADGTGDALAKWATCVTEQAARGELDPVVG
RDDELRTVIDILSRRRQNNPILVGEAGVGKTAVVEALAQKIHAGAVPPGLVGAQVWALDLARMQAGAGVR
GEFEQRLKSLIDAVIASPAPIILFCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQY
IEPDAALVRRFQAVAVDEPSDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAIS
LLDTACARVAMSQSCAPAELERLQHQAFAIGQTLDWRASDRRMGVRTPGDEAELEGRQASLAQQAATLET
VVDAQRDEVRAWLARLNDATPQAADGDGAAFAARIGANRWVRPWVDEHVVSEVLAEWTGVPVAQLAQDDA
QRVVELEAALNAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLGVMLLAGPTGTGKSQAAAKLAELLFGGE
RNLLQFNMNEFQEAHTVSTLKGAPPGYVGYGKGGRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQ
GWMEDGEGRRISFRNCLILLTSNLGEAEIEAACKADPRISQAKLDKLVGERLQGRFSPALLARIQLVAFR
TLDVDALTGIATQALDELGERLAQNDLQWRADEGVASWIAHAVSQHPANGRAVRDLLRQHVMPAVARGVL
AARAEGRALQTVRLAANEKLSLVFDEDAWELSGTDAASLGEQAQAVAMAREAEAVAAAVAAREAHGARGT
NEADGGGGAPHAAKADAHVDSDDERPGGAPHPDETASANAGTTGEPSCV
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1087791-1085122 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGGAGAAGGCGCTCGACGGCTTCGACGTGAGCGGCGACTCGCTGCGCGACATCTCCAGCTCGCTGGAGC
GCAGCGTGGGGCCGGCCGTCATCTGGAGCCAGATCGCGGCGCGCGCGGGCAAGGTGCGCTCCGGCCACCT
GCTGCTCGCGTGGCTCGACGAGGATCTGACGCGCCGCTGGCTGCAGCAGCGCGTGCCGAGCGGCATCACG
TCGGTGGCGCTCGACGACGTAGTGAAGCGCTATGAGGCGCTCGCGGCGGGCTGGCCGGAGGCCGACGAGG
CGCCGGCCGCGCTGGACGGCGCGGCGCTGGGCGCGCAGGCGGGCGAAGCCGGCGCAGACGGCACGGGCGA
CGCGCTCGCGAAGTGGGCGACGTGCGTGACGGAGCAGGCCGCGCGCGGCGAGCTCGATCCGGTGGTGGGG
CGCGACGACGAATTGCGCACGGTGATCGACATTCTGTCGCGCCGCCGGCAGAACAACCCGATCCTCGTGG
GCGAGGCGGGGGTGGGCAAGACGGCCGTGGTCGAGGCGCTCGCGCAGAAGATCCACGCGGGCGCGGTGCC
GCCGGGGCTCGTGGGCGCGCAGGTGTGGGCGCTCGACCTGGCGCGGATGCAGGCGGGCGCGGGGGTGCGC
GGCGAGTTCGAGCAGCGCCTGAAATCGCTGATCGACGCGGTGATCGCCTCGCCCGCGCCGATCATCCTGT
TCTGCGACGAGACGCACACGCTGATCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCCAACCTGAT
CAAGCCGATGCTCGCGCGCGGCCAATTGAGGATGGTCGCGGCGACGACGTGGTCCGAATACAAGCAGTAC
ATCGAGCCGGACGCGGCGCTCGTGCGGCGCTTCCAGGCGGTCGCGGTCGACGAGCCGAGCGACGATGCGG
CGGTCGACATGCTGCGCACGATCGCGCCGCGCTTTGCCGCGCACCACGGCGTGCGCATCGTCGATTCGGC
GCTGCGCGGCGCGGTCGAGCTGTCGCGCCGCTATCTGCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGC
CTGCTCGACACCGCGTGCGCGCGCGTGGCGATGAGCCAGAGCTGCGCGCCCGCGGAGCTCGAGCGCTTGC
AGCACCAGGCGTTCGCGATCGGCCAGACGCTCGATTGGCGCGCGAGCGACCGGCGCATGGGCGTGCGCAC
GCCGGGCGACGAAGCCGAGCTCGAAGGCCGTCAGGCGAGCCTCGCGCAGCAGGCGGCGACGCTCGAGACG
GTCGTGGACGCGCAGCGCGACGAGGTGCGTGCGTGGCTCGCGCGGCTGAACGACGCCACGCCGCAGGCGG
CCGACGGCGACGGCGCTGCGTTCGCCGCGCGCATCGGCGCGAATCGCTGGGTGCGGCCATGGGTCGACGA
ACACGTGGTGTCGGAGGTGCTCGCCGAATGGACGGGGGTGCCCGTCGCGCAGCTCGCGCAGGACGACGCG
CAGCGCGTGGTGGAGCTCGAGGCGGCATTGAACGCGGGCATCCACGGGCAGACGGGCGCGATGCGCTCGA
TCGCGCAGGCGCTGCAGGTGTCGCACTCGGGGCTGAACGATCCGCGCCGCCCGCTCGGCGTGATGCTGCT
CGCGGGGCCGACGGGCACGGGCAAGAGCCAGGCGGCCGCGAAGCTCGCCGAGCTGCTGTTCGGCGGCGAG
CGCAACCTGCTGCAGTTCAACATGAACGAGTTCCAGGAAGCGCACACGGTGTCGACGCTCAAGGGCGCGC
CGCCGGGGTACGTCGGCTACGGCAAGGGCGGTCGGCTGACCGAGGCGGTGCGCAAGAAGCCGTACAGCGT
GCTGCTGCTGGACGAATTCGATCGCGCGCATCCGGACATTCATGAGGTGTTCTATCAAGTCTTCGATCAG
GGGTGGATGGAGGACGGCGAAGGTCGCCGGATCAGCTTCCGCAACTGCCTGATCCTGCTGACGAGCAATC
TGGGGGAGGCGGAGATCGAAGCGGCGTGCAAGGCCGATCCGCGGATCTCGCAGGCGAAGCTCGACAAGCT
GGTGGGCGAGCGGCTGCAGGGGCGTTTCTCGCCGGCGCTGCTCGCGCGGATTCAGCTCGTGGCGTTCCGC
ACGCTCGATGTCGACGCGTTGACAGGCATCGCGACGCAGGCGCTGGACGAGCTGGGCGAGCGCCTGGCGC
AGAACGATCTGCAATGGCGCGCGGACGAAGGCGTGGCGTCGTGGATCGCGCATGCGGTGTCGCAGCATCC
GGCGAACGGACGCGCGGTGCGCGACCTGTTGCGCCAGCACGTGATGCCGGCCGTGGCGCGCGGCGTGCTC
GCCGCGCGTGCGGAAGGGCGAGCGCTGCAGACGGTGCGGCTCGCGGCGAACGAGAAGCTGTCGCTCGTGT
TCGACGAGGACGCGTGGGAACTGAGCGGCACCGATGCGGCATCGCTCGGCGAGCAGGCGCAGGCGGTGGC
GATGGCGCGCGAGGCGGAGGCGGTGGCCGCTGCCGTGGCGGCACGCGAAGCGCACGGCGCGCGCGGCACG
AATGAGGCGGATGGAGGTGGCGGCGCGCCGCACGCGGCGAAAGCCGACGCGCATGTCGATTCGGATGACG
AACGTCCAGGCGGCGCGCCTCATCCCGATGAAACGGCTTCGGCGAACGCCGGCACGACGGGAGAACCGTC
ATGCGTCTGA