SecReT6
Protein ID: 124382197
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1036
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1082885..1085131 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA2RYS5
KEGG IDbml:BMA10229_1036
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 677..705
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 366..459
Protein Sequence: 748 a.a.     [Download]
>gi|124382197|ref|YP_001024844.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALFGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSVVGISISFTGISVSYTGLSVSFTGVSASFTGVSTSFTGVSTSFT
GVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSMTGISSSWTDVSMSTT
GQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTT
DSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1085131-1082885 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCTTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGACCCGGATCTGGACTTCGACGC
GCTGTTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGTACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAGGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGTATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGGTCGTCGGCATCTCGATTAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAG
CTTCACCGGCGTGTCGGCGAGCTTCACGGGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACC
GGCGTGTCGACGTCGTTTACCGGCGTCGACACCGGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCG
ATACCAGCTTCAAGGGTGTGTCGACTTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTC
GGTGACGGGCGTATCGAACAGCATGACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACC
GGCCAATCCCAAAGCATCACGGGGGTATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGA
GCACGTCGGTGACGGGCACCTCGACGAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAG
CATCACGGGCACGTCGATGTCGACGACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACC
GACAGCTCGGTGAGCACGACGGGCTCGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACGGGTTTCA
GCTTCTCGTACACCGGCGTCAGCTATTCGGACACCGGTATCGACCTGAAGAAGGTCGGCATGCAAGTGAA
GAGCTGA