SecReT6
Protein ID: 124382296
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1041
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1090857..1091288 [-]
Producthypothetical protein
NoteTssE
UniProt IDA2RYT0
KEGG IDbml:BMA10229_1041
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-11, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|124382296|ref|YP_001024849.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1091288-1090857 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGG
CCGACCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGCTGAACTTCGGTTGTCCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCATATCTGCGAGGTGATTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGG
TGGTCAAGCCGCGCACGGAGAGCCGCAAGCGCCTCGCGCAGACGATTTATTTCGACGTGTCGATGAAGGC
GCGCGAAGACGGAGCCGAACTCAGGGCGAGCCTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCG
GACGACCGATGA