SecReT6
Protein ID: 124382415
SecReT6 ID172
T6SS typei1
Gene symbolvirG
Locus tagBMA10229_0713
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]749938..750675 [-]
ProductDNA-binding response regulator
NoteVirG
UniProt IDA2RXV9
KEGG IDbml:BMA10229_0713
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.50E-20, Aligned region: 10..117
Trans_reg_C [PF00486], Evalue: 9.70E-20, Aligned region: 161..235
Protein Sequence: 245 a.a.     [Download]
>gi|124382415|ref|YP_001024528.1| virG gene product [Burkholderia mallei NCTC 10229]
MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVL
LRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRA
YRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWR
LRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG
 
Nucleotide Sequence: 738 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c750675-749938 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACGAATGTGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTT
GCAATTACCTGTCGGGCCACGGGATGGCCGTGGACGGCGTGGGAACGGCGGCAGCGGCCGCCGAATCGGT
CGGGCGGCGCGAATACGAGATGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTG
CTGCGCTGGCGCGAAACGCAGCGCTTTCCGCTCATCTGCGTGACGGGGCGCAGCGAAGAGGCCGATCGCA
TCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCCCG
GATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGCGCGGCAGGCATCCGCGTGCG
TACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCGCAGGAAATTC
CGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGG
CTGCGCAAGAAAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACT
ACTTCGACGCGAAAGAGGTGGAGACGCTATGGGGATGA