SecReT6
Protein ID: 124382441
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1040
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1088981..1090843 [-]
Producthypothetical protein
NoteTssF
UniProt IDA2RYS9
KEGG IDbml:BMA10229_1040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-127, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|124382441|ref|YP_001024848.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPGRKLPVMFSTAREVTLLPLRL
ASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIAELAREDDGFKPLHLSVAGDLPRAYALHRAL
LADTTAWYALVSTNRGDEVLPLPMSGIRLSGVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFDLFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVATRDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1090843-1088981 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGAACTTCCTCGATCACTACAACGACGAATTGCGCCAGTTGCGCGATGCGGGCGCACGCTTCTCCAAGG
AGCACCCGCAGGTGGCCTCCGCGCTCGGGCTGCATCCGGATGCGGTCACCGATCCGTTCGTCGAGCGCCT
GCTCGAGGGCGTCGCGTACCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACACGGCTTCGACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCCGATCTCGGCTCGCCCGATGCGTTTCGCGGCAACACGCTGCCGCGCGGCTCGCTCATCGCCGCGCA
CCTGCCCGGGCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGAGGTCACGCTGCTGCCGCTGCGTCTC
GCATCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCGCGCAGCGGCTCGCCTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGATCGAGGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
CGGCTTCAAGCCGCTGCATCTGAGCGTGGCGGGCGATCTGCCGCGCGCATATGCGCTGCACCGCGCGCTG
CTCGCCGACACCACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGTGACGAGGTGCTGCCGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGACGAGGAGGCGCTGCTGCCCGAGGCGTTCGGCGGGCTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCCACGCGGCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCGAAGGCACCGTCCGCGCGCGCGTTCGATCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTGGGCGACGTCGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGACCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTCACCGAGGTGTTCGTGTGCGAGACCAACGGTCGCGCGCACCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTACGAAGGGCACGAAGGCTCGATCCGCTACGGCATGCGGCGCGA
GGACGCGCTGCTCGTCGACGGCGTGCGGCGCGACCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGAGCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGCCCGAGCGCTCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACCGCGGTCAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCGGTC
TCGCACGTCGGGCGCAACCCGCTCGCGCTGCGCGCGTCGCAGCAGCAGGACGTGACGGCGCGCATCGTCG
AGCAGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGATCGCCAGCGGCTCGAGAGCCTGCGCTCGGT
CGTGCTGCGCTCGCGCTTCGTCGCGGCGGGGCGCGCCACGCCCACCGCGCTGGTGCGCGCGACACAGGTG
GAGATCGACATCGCCGAATCGCTGCACGCCGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCGGAGGCCGCCACGCTCAACGACGGCATCGAGATCGTGGTGCGCCTGGACGGCGAAGCGGCGAG
CACGCACACGAACGTCGCCACGCGAGACGGGAGGCTCGCATGA