SecReT6
Protein ID: 124382482
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0733
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]777767..778621 [+]
Producthypothetical protein
NoteBMAA0729 (e)
UniProt IDA2RXX9
KEGG IDbml:BMA10229_0733
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 1.70E-09, Aligned region: 5..85
Big_5 [PF13205], Evalue: 1.70E-09, Aligned region: 268..278
UCH [PF00443], Evalue: 2.10E-08, Aligned region: 92..124
UCH [PF00443], Evalue: 2.10E-08, Aligned region: 233..265
Peptidase_C98 [PF15499], Evalue: 0.0062, Aligned region: 101..150
Peptidase_C98 [PF15499], Evalue: 0.0062, Aligned region: 231..268
Protein Sequence: 284 a.a.     [Download]
>gi|124382482|ref|YP_001024548.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRST
TGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAA
SADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLN
SYPPLSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEI
AIYR
 
Nucleotide Sequence: 855 bp     [Download]
>gi|124381141|ref|NC_008835.1|:777767-778621 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
TTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGTTCAGTCCCACACATCGTGC
TGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGAGCGATCGCCGGATCGCGTT
CGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCCCGCCGGCATCAGGAGCACC
ACGGGCGAACGGTCGGCCCATCCGCTAACGAGCAGCTTCGATACCGCGCCCGTTACGCCGCCGCGCGGCC
TGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACTCGTCGGCGCT
CGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTACGACGCCGCA
TCGGCTGATGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCACGCCGGAGGTCCCGG
ACAGCGGGCCGGGACAAACGCTGGAAGTGATGCAAGCGTTGCGGATGCCGTTATATGACACGAGCAGCGC
GAACAACGCAACGAACAACGCCGACGCCATACGTCATGCGCCGCCCAACACCAAGGCGTTCTTTCTGAAC
TCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTCGCGTTCGACTACAGCACGG
GCGGTCACTATGTCGCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCGACGATGCCCAGGTCAGCGC
CGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGGCAGCGTGTCGATCGAAATC
GCGATCTATCGATGA