SecReT6
Protein ID: 124382484
SecReT6 ID175
T6SS typei3
Gene symbol-
Locus tagBMA10229_1787
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1828980..1830851 [+]
Producthypothetical protein
NoteTssF
UniProt IDA2S0W5
KEGG IDbml:BMA10229_1787
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-218, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|124382484|ref|YP_001025585.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWP
LELADASVTGAPAYLPRSATAARRDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEQRDDGQTRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPRPPLADAQSAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1828980-1830851 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTATCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGTTGCTCGAAGGCTTCAGCTTTCTCACCGCGCGCGTGCAACTGAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGTTACGTCGCGCCGCTTCCGTCGATGGCGATCGTGC
AGTTCACGCCGATGATGAACGAAGGCAGCCTCGCGCAGGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCCGCCGCGGCCGAACAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACGCTGTGGCCG
CTGGAGCTCGCGGACGCTTCGGTGACGGGCGCGCCCGCGTATCTGCCGCGTTCGGCGACGGCAGCGCGCC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCGCGCGGCGGCGCGGGCCTCGCGCAACTGCCGAT
CGATCGGCTGATGTTCCACCTGGCGGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGCGCTTGGCGCGCACG
CGCTCGCGCATCAGGGCTTCGACGCCGATCAGGCGCTGCTGCCCGACGAAGGCCGCAGCTTCCACGGTTA
CCGGCTGCTGCGCGAGTACTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACCTCGCGTTGAACTGCACGCCGGCCGTCAACCTGTTCGCGCGGCGCGC
GGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGGCGGCTCGCGGGCGAGCAGCGCGACGACGGGCAGACGCGCGCGTTCCGGC
CGTTCCATGCGTCGTTCGCGGGCGACGGCGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGCGTGCGCGCCGTATGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ACCGCGATCTCGTCCTGCTGTTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCATGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGCTCGCCGACGCGCAGAGCGCGTGG
CGGCTCGTGAGCCATCTCGGGCTCGCGCGCCACACGCTGACCGATGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAATTGCTCGGCCTGCACGCGGACCCGGCCGATGCGGCGATGCGCCGGCAGATCGACGGTGT
GCATCGCGTCGCGTTCGCGCCGGTGTTTCGCCGGCTGCCCGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCATGCGTTTTCCGGCGACAGCCCCTATTTGCTCGGTGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA