SecReT6
Protein ID: 124382503
SecReT6 ID175
T6SS typei3
Gene symbol-
Locus tagBMA10229_1782
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1824624..1825703 [+]
Producthypothetical protein
NoteTssA
UniProt IDA2S0W0
KEGG IDbml:BMA10229_1782
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 56..116
Protein Sequence: 359 a.a.     [Download]
>gi|124382503|ref|YP_001025580.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELTAR
TKDLRVAAHLARSWTELRGMPGYADGLRLVAGMLDRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRAR
VASALGGEWVPDASDFEKALRRIVRDGLPPPAAAPAATNGAANVANAAHGGAANGVTNSAANGAASGGAP
AFAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKL
DLLSGQRNE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1824624-1825703 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCAGAGTTCAGACCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAGAGCGCGACGCCGCGGCCCGAACAGCAGTACGGCGA
CACCGTGATCCCGGCCGAAGCGCCGGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAACTGCGCGGCATGCCCGGCTACG
CGGATGGGCTGAGGCTCGTCGCGGGGATGCTGGACCGGTGGTGGGACGACGTGCACCCGCGCCTGGACGC
CGACGGCGACCACGACCCGGCCCCGCGCGCGAACGCGCTGGCGGAAATCGCGGGCGCGCACGACTGCGCG
CGCGCCGCGCGCCGACAGGCGCTCTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAGCGCGTGTTCGATG
GCCGCGACGGCGGCGAGCACGGCTACCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGACGCTGCAGGCGGCGTTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCATCGGCGCTCGGCGGCGAATGGGTGCCCGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGTTGCCGCCGCCCGCGGCCGCGCCCGCCGCGACAAACGGCGCGGCGAATGTGGCGAATGC
GGCGCACGGCGGCGCGGCAAACGGCGTCACGAACAGTGCCGCGAACGGCGCGGCTTCGGGCGGCGCGCCG
GCTTTCGCCGCGAACGGCCGCGCGTGGCGCGACGCGGAGCTGACGAGCCGCGACGACGTTCAGCTCGGCC
TCGAAAAAATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCATCCGGCGCCGATCCTGCTGCGCCGCGC
GCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTC
GACTTGCTGAGCGGCCAGCGCAACGAATGA