SecReT6
Protein ID: 124382529
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1045
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1094129..1095067 [-]
Producthypothetical protein
NoteTssA
UniProt IDA2RYT3
KEGG IDbml:BMA10229_1045
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-16, Aligned region: 46..104
Protein Sequence: 312 a.a.     [Download]
>gi|124382529|ref|YP_001024852.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWH
LRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYRLRANTLVHGIQDSLSRIRESIAAAEQELNVSRVLDLLSVAASRLTQAQA
GGADSASVESDAPVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 939 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1095067-1094129 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGAACAACGATGCACTCCCGGGCCATTCGCCGGATTTGCTGGATTTCGACGAAGACTTTATCAAGATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTACGCGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTG
GGCGTCCATCGAAACGGGATGTCTCGCTTTGTTGAAGAAGGCGAAGGATGTCCGGGTCGGCATTTGGCAT
CTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGGCTGGCAGACGGCGTTCGATCGCTGGCCGATCTGA
TGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAATCGCCCGGCGAAACCCTCCTGAT
TCATCTCGGCTGGCTTGCGGGCCCGCAGTTTCTGCATCAGCTCGGCAGTTCCCGGTTCGAAGACCGGGAC
GCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCGGCGATCGTGGAGGATCGCGACTATCGCCTTAGAG
CGAATACTCTTGTACATGGCATTCAGGATTCCTTATCGCGAATTCGGGAATCGATCGCCGCGGCCGAGCA
AGAGCTCAACGTCTCGCGCGTGCTCGACCTGTTGAGCGTCGCGGCGTCTCGGCTCACGCAGGCACAAGCC
GGCGGCGCGGACAGCGCAAGCGTCGAGAGCGACGCGCCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCG
GCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGTTGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGA
TCGGATCGTGGAGTACTTCCGCGTGCACGAACCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAGCCGGCCGCAGAGTTCCAAGTAA