SecReT6
Protein ID: 124382613
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1028
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1074033..1074641 [-]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.20E-57, Aligned region: 2..197
Protein Sequence: 202 a.a.     [Download]
>gi|124382613|ref|YP_001024836.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MRLANLDAFDPLPPAMLYHELVGLLGRLSVLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIE
TPVLPLRFEDRGDQVHICIVDKQWNLKKLIFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGAR
LNALPNPPRQIPYYAQSTYFEVESTDPFWKQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 609 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1074641-1074033 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCGCTTGGCGAACCTCGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCC
TGCTCGGGCGGCTGAGCGTGCTGCCGGGCGTCGACGAGGAGCTGGCCGACCGCGAGCTCGGCTACGACCA
CGACGATCTGCAGACGAGCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAG
ACGCCGGTGCTGCCGCTGCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGT
GGAACCTGAAGAAACTGATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCC
GCAGCAGACGAAGCTGGGCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGG
CTGAACGCGCTGCCCAATCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAAT
CGACCGATCCGTTCTGGAAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCC
CGATCTTCGCTTCGAAGCCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA