SecReT6
Protein ID: 124382985
SecReT6 ID175
T6SS typei3
Gene symbol-
Locus tagBMA10229_1788
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1830848..1832326 [+]
Producthypothetical protein
NoteTssG
UniProt IDA2S0W6
KEGG IDbml:BMA10229_1788
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-130, Aligned region: 81..439
Protein Sequence: 492 a.a.     [Download]
>gi|124382985|ref|YP_001025586.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNAVRGAAADVAPSAAPSATPSATSQAAA
ARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGP
RPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPA
RARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSLPDSPPDSSPDSPPDSRSDSPSDARLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREPPCPIS
AE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|124381141|ref|NC_008835.1|:1830848-1832326 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGTGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCAGTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCGAGCGCGACGTCGCAGGCCGCCGCC
GCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGTTTCATGCGCTGC
GTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCGCGACGAGCCGGT
GCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGTGACGACGGCCCG
CGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCG
AGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGACCTGTTTCATCA
TCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTCGATCGGCCGGCG
CGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTGCCGATTCACCGC
GCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCCGCCTGATTCGCGGTCCGATTCGCCGTCCGATGCGCGCCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGTAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTGATCGCCAACCTGCCTGAACGGGAACCGCCATGTCCGATATCG
GCCGAGTGA