SecReT6
Protein ID: 124383009
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0712
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]748031..749947 [-]
Producthypothetical protein
NoteTssA
UniProt IDA2RXV8
KEGG IDbml:BMA10229_0712
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 598..608
Protein Sequence: 638 a.a.     [Download]
>gi|124383009|ref|YP_001024527.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MGMSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAEAAEAAEAAEAAEAAEAADVADVADVADVADVADVADVAETAEADAHGSTGGPAAEIAIAAAE
QALIDPAGRAAPSAGTDTNANADAARQPARLDEAAGRDRALADALAQLHCVATAFAQADWADARGFRLRR
VACWSSVCALPETDAENGRTRIAAPSASIVGAAKNIDEDGEPVAAVRFAEAHAQAFPLWLDLQRIAARAL
ARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSP
RPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRL
CELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDA
ARAMRLSM
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c749947-748031 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCCAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCTGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGG
CGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGA
GACGGCCGAGGCCGATGCGCACGGCTCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGCCGCCGAA
CAGGCTTTGATTGATCCGGCCGGTCGAGCCGCGCCGAGCGCCGGCACGGATACGAACGCGAACGCAGACG
CCGCCAGGCAACCGGCGCGGCTCGACGAAGCGGCCGGCCGCGACCGCGCGCTCGCCGATGCGCTCGCGCA
ATTGCATTGCGTCGCGACGGCGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGC
GTCGCGTGCTGGTCGAGCGTGTGTGCGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCG
CGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGAACATCGACGAGGATGGCGAGCCCGTGGCGGCGGTGCG
CTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTC
GCGCGCGCGGGAGGCGACGGCGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCACTGCTTGCGC
GGCTGCCGGGCCTCGACGCGCTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATG
GCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCG
CGACCTTCGCCGCCTGAGCGATCGTCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCG
GGGCGAGCGCCGACGATGCAGTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCT
CCACGCGATTCAGCATGCGATCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCGCGCGTGCGGTTG
TGCGAGCTTGCGCGCGACCATTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGA
TTCGGCGGCACGATTTGCTCGCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCT
GCTGATTCGGCGCGATCGCGAATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCG
GCGCGGGCCATGCGTTTGTCGATGTGA