SecReT6
Protein ID: 124383065
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1039
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1087995..1088984 [-]
Producthypothetical protein
NoteTssG
UniProt IDA2RYS8
KEGG IDbml:BMA10229_1039
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|124383065|ref|YP_001024847.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEVERVQVTLARF
VEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRRAFPGIYCAPRRSLADLQRLLRAYFGVALQV
VPRHGRWVPVPAAASHARRLGGWRLGARIWDVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1088984-1087995 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGACGCCGCTCGAGCGCGTGAGCCGGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAGGCGCTGCAGCGCAGGCACGACGGGCGTTCGGCGCGCAAGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGCAGATGCACTTCGCGAGCACGGAAGTCGAGCGCGTGCAGGTGACGCTCGCGCGCTTC
GTCGAGGACGACGATCACCCGCAGGTCACGGTGGCGCAGCGCCATTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTAAACGTCGCGTGCGGCGATCTCGCGTGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGTGCCGCGCGC
AGCAGGACGACGGCGAGCCGTACGGGCGGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGCCGCTCGCTGGCCGATCTGCAGCGGCTGCTGCGCGCGTACTTCGGCGTGGCGCTGCAGGTC
GTGCCGCGCCACGGGCGCTGGGTGCCGGTGCCGGCCGCGGCGAGCCATGCGCGGCGGCTCGGCGGCTGGC
GGCTGGGCGCGCGGATCTGGGACGTGCAGCACTCGATCGAGATCGTGGTGGGGCCGATCGAGGCGGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCGGCGGTCGTGACGGATTTCGTCGAC
GGACGGATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGTGTCGGGGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG