SecReT6
Protein ID: 124383073
SecReT6 ID173
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_1027
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]1072268..1073950 [-]
Producthypothetical protein
NoteTssL
UniProt IDA2RYR6
KEGG IDbml:BMA10229_1027
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-42, Aligned region: 130..325
OmpA [PF00691], Evalue: 5.10E-10, Aligned region: 384..491
Protein Sequence: 560 a.a.     [Download]
>gi|124383073|ref|YP_001024835.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNP
AVLQFPVPGGAPAPADARVAAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRH
LAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLL
VEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHH
VPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAE
TLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTD
SRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERN
RRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMPATRPTTEGRQP
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|124381141|ref|NC_008835.1|:c1073950-1072268 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCG
CGGCGATGACGAGCTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGC
GGGCGCGCCGAGCTTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCC
GCGGTGCTGCAATTCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGCCG
ACGCGCGGGTGGCCGCGCCCGTCGTCTATAGCGCGCAGGGCGAGCAGGCCGCGATCATGAAAGCAGGCCT
GCAGCAGGCGAGCTGGAACAACCCGTTCGTGTCGCACGCGCTGCCCGCGGTGCTGCAACTGCAGCGCCAC
CTCGCGGCCGGCCCGCTCAATCAGGCCGCGATCCGCACGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCG
AGCGGCTCGCCGCCTCCGGCTGCGAATGGGAGCAGATCCGCGACGCATCGTACCTGCTCTGCACGTATCT
CGACGAAACCGTCAACGACGCGGCGCGCGAGCACGCGCAAGTCGTCTACGACGGCGAGCGCAGCCTGCTC
GTCGAATTCCACGACGACGCGTGGGGCGGCGAGGACGCGTTCGCCGACCTGTCGCGCTGGATGAAGACCG
AGCCGCCGCCGATTCCGCTTCTGTCGTTCTACGAACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCG
CGTGCTCGACCGCGTCGACGTGCTGCTGCAGGATCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCAC
GTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTCGCGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCG
GGCGCGCGGCGGCCGTCGCGCTCGGCGTGCTGGTGCTCGCGTACGGCGCGATCAGCTTCTGGCTCGATTC
GCAGGGCCGCCCGATCCGCAACGCGCTCGCCGCGTGGATGCCGCCCACGCGCACGATCAACATCGCCGAG
ACGCTGCCGCCGCCGCTGCCGCAGATTCTCACCGAAGGGTGGCTCACCGCGTACAAGCATCCGCAAGGAT
GGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCGACGTCGGCAAGGCGAACGTGCGGGCGGACTTCATGCA
CAACATCGAGCGGCTCGGCCTCGCGTTCGCGCCGTGGCCGGGCGACCTCGAGGTGATCGGCCACACCGAT
TCGCGGCCGATCCGCACGAGCGAGTTCCCGGACAACCAGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCG
CCGACGAACTGCGCAAGACCGCGCTGCCGGGCGGCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAACAT
CGAGTACTCGGGGCGCGGCGACGCGCAGCCGATCGACACCGCGAAGACGGCCGCCGCGTACGAGCGCAAC
CGCCGCGTCGACGTGCTGTGGAAGGTGATTCCCGACGGCGCGCAGCAATCGGGCCGCAGCCTGAACCTGC
AGCAGCCGGAGAAGCCCGGGCAGGTGCCGATGCGTCCGGCGATGCCGGAGGGCGTGGAGATCGCGCCTGA
CGGGCAACTGCCGTATGCGACGTCAACCACGATGCCAGCAACGCGACCGACCACGGAGGGCCGTCAGCCA
TGA