SecReT6
Protein ID: 124383212
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0729
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]772051..772716 [+]
Producthypothetical protein
NoteTssL
UniProt IDA2RXX5
KEGG IDbml:BMA10229_0729
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-44, Aligned region: 1..208
Protein Sequence: 221 a.a.     [Download]
>gi|124383212|ref|YP_001024544.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLN
SGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAI
RQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIV
RMVDAVYPRLQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|124381141|ref|NC_008835.1|:772051-772716 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGAAGCTGACCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGG
CGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTGAAC
AGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACG
CGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCT
GCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATC
CGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCG
CCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGC
GGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTG
CGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGA