SecReT6
Protein ID: 124383316
SecReT6 ID172
T6SS typei1
Gene symbol-
Locus tagBMA10229_0716
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]753270..754796 [+]
Producthypothetical protein
NoteTssC
UniProt IDA2RXW2
KEGG IDbml:BMA10229_0716
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-187, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|124383316|ref|YP_001024531.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTAL
FDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEER
VDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHF
KYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|124381141|ref|NC_008835.1|:753270-754796 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGC
CGGACGCGACGCCGCCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAAGACGCATACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGATCGACGCGATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTT
TCTCGTCGATCGAACGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTG
TTCGACGACTTCGAGGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGT
ACGGCCAATTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGA
CGTCAAGCTGCTGCAGTACGTCGCGAGCACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGG
GGCCGCAATACGCGAAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCTTGCTGCGGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGC
GTCGACGGCGGCGACGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCC
GCTCTACGCGTACGAATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCT
TTTTCTCCGCGAACTCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCT
CAACTATCGGCTCAGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTG
ATCCAGCGGGAAAACATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGTCGACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCA
GATCGTCGTGTCGGACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTC
AAGTACATGGGCGCGTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG