SecReT6
Protein ID: 126439263
SecReT6 ID178
T6SS typei4b
Gene symbol-
Locus tagBURPS668_3633
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]3559751..3560254 [-]
Producthypothetical protein
NoteTssD
UniProt IDA3NE67
KEGG IDbpd:BURPS668_3633
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-45, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|126439263|ref|YP_001060638.1| hypothetical protein BURPS668_3633 [Burkholderia pseudomallei 668]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|126438353|ref|NC_009074.1|:c3560254-3559751 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCCGACAAGGACCACGAAG
GCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCGTCGACGGCGGG
CGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACG
GCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA