SecReT6
Protein ID: 126439645
SecReT6 ID178
T6SS typei4b
Gene symbol-
Locus tagBURPS668_3630
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]3556229..3557329 [-]
Producthypothetical protein
NoteTssG
UniProt IDA3NE64
KEGG IDbpd:BURPS668_3630
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|126439645|ref|YP_001060635.1| hypothetical protein BURPS668_3630 [Burkholderia pseudomallei 668]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAH
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFRVPIRVEQFVGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTRE
AGRDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|126438353|ref|NC_009074.1|:c3557329-3556229 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTTCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCACGATGCGCCGCGCCACGCGGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGCATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGCAGCCGGCGCCGCGCTGAAGGACGACGTGCGGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAGCAACTGAAGCGCGACCATGCCGCGCAC
GCGTTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTATTCGGCATGGAAGAAGTACCGTCTGC
CGCTGCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTCCTGCTCGCGCTCGCGGGCGTGTCGAA
CGACGACGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGACGAGGCGATCGCGGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCCGCGTATCTGCAGCGCACGCTGTCCGAATATTTTCGCGTGC
CGATCCGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAATTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGTCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCGGGCGTGACGCTCGAATACGAGGTGTCGCTCGTACTGCGCCGCGC
GGAAGTCGGCGCGAGCGTGCTCGGCGCGGGCGCGCGGCTCGGCTGGGACGCGTTTCTCTGCACGCGCGAA
GCCGGGCGCGACCGTGCGGACGCGCGCTACGAGCTGCATGTCATTCATTGA