SecReT6
Protein ID: 126441892
SecReT6 ID178
T6SS typei4b
Gene symbol-
Locus tagBURPS668_3632
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]3559211..3559693 [-]
Producthypothetical protein
NoteTssE
UniProt IDA3NE66
KEGG IDbpd:BURPS668_3632
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|126441892|ref|YP_001060637.1| hypothetical protein BURPS668_3632 [Burkholderia pseudomallei 668]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|126438353|ref|NC_009074.1|:c3559693-3559211 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCACGTGCCGGCGCCCGCCG
CGATGCGGCAGTTGTCGTTGGAGGAGCTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCCGAATGCCAGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGATCGCACGTTCATCTGCAAATCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGGCGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAACCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA