SecReT6
Protein ID: 126442128
SecReT6 ID178
T6SS typei4b
Gene symbol-
Locus tagBURPS668_3639
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]3564098..3565504 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3NE73
KEGG IDbpd:BURPS668_3639
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-135, Aligned region: 39..466
Protein Sequence: 468 a.a.     [Download]
>gi|126442128|ref|YP_001060644.1| hypothetical protein BURPS668_3639 [Burkholderia pseudomallei 668]
MPNATRINRPTAQSHLSGFDMSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRF
DRDALGSNVLRASELSLVFPDGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRD
AGFVSRFVSEQASVADHFTDAAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDSFVPP
CLAIEASPILHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHS
ALHPERLFQELLRLAGQLMTFSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVR
PSFHVGRLDSGKIDDKTAFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPA
IPVRPGACYFALDARSPLYERMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|126438353|ref|NC_009074.1|:3564098-3565504 Burkholderia pseudomallei 668 chromosome I, complete sequence
TTGCCGAACGCGACGCGAATTAACCGACCAACGGCCCAATCACATTTAAGCGGATTTGACATGAGTTATT
CGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGGACGCGTATCA
CGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTCGGTGCGGTTC
GATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCGGACGGCGCGC
TCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCGAAGGCATCAA
CGAATTCACGTTCTACCTCGCGCTTCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGACGACCGCGAC
GCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGACGCCGCGGAAG
CGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACCAGTTGCTGTC
GATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTTCGTGCCGCCG
TGCCTCGCGATCGAGGCGTCGCCGATCCTGCACCAGCGCCTGCGCCAGTTGATCGACGCGCTGCAGGCGA
AGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCTCGGGCGACAT
CGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCACCAGCATTCG
GCCTTGCATCCGGAGCGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACGTTCTCGAAGG
GCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGCGGCTCGATTC
GATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGAGGAAGTGCGG
CCGTCATTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTATCTCGCGGTGT
CGGCCGACATGCCGTCGGTCGAACTCGTCGACGCGGTGCCCGCGCGCTTCAAGGTGGGCGCGCCGGACGA
CGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGTGCCGCCCGCG
ATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAGCGGATGCTGC
AGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGATCGCCGTCAC
GTCATGA