SecReT6
Protein ID: 126442318
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2960
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2813404..2813982 [-]
Producthypothetical protein
NoteTssB
UniProt IDA3NNN0
KEGG IDbpd:BURPS668_A2960
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-58, Aligned region: 15..166
Protein Sequence: 192 a.a.     [Download]
>gi|126442318|ref|YP_001063951.1| hypothetical protein BURPS668_A2960 [Burkholderia pseudomallei 668]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2813982-2813404 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGCCGTTCGTGATGGGCGTGAT
CGCGGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGAC
GTCGACAATTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTGGCCTCGCTCG
TGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA