SecReT6
Protein ID: 126442377
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0804
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]778677..780335 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3NHI2
KEGG IDbpd:BURPS668_A0804
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 122..317
OmpA [PF00691], Evalue: 5.00E-10, Aligned region: 376..483
Protein Sequence: 552 a.a.     [Download]
>gi|126442377|ref|YP_001061803.1| hypothetical protein BURPS668_A0804 [Burkholderia pseudomallei 668]
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNP
AVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQ
AAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAW
GGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGT
ELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQ
ILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSE
FPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWK
VIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMPATRPTTEGRQP
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|126442307|ref|NC_009075.1|:778677-780335 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCG
CGGCGATGACGAGCTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGC
GGGCGCGCCGAGCTTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCC
GCGGTGCTGCAATTCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCG
TCTACAGCGCGCAGGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCC
GTTCGTGTCGCACGCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAG
GCCGCGATCCGCACGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCG
AATGGGAGCAGATCCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGC
GCGCGAGCACGCGCAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGG
GGCGGCGAGGACGCGTTTGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGT
CGTTCTACGAACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCT
GCTGCAGGATCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACC
GAGCTCGTCGCGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCG
GCGTGCTGGTGCTCGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGC
GCTCGCCGCGTGGATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAG
ATTCTCACCGAAGGGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACG
GCGCGTTCGACGTCGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGC
GTTCGCGCCGTGGCCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAG
TTCCCGGACAACCAGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGC
TGCCGGGCGGCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGC
GCAGCCGATCGACACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTATGGAAG
GTGATTCCCGACGGCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGG
TGCCGATGCGTCCGGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTC
AACCACGATGCCAGCAACGAGACCGACCACGGAGGGCCGTCAGCCATGA