SecReT6
Protein ID: 126442544
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0792
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]761294..761725 [+]
Producthypothetical protein
NoteTssE
UniProt IDA3NHH0
KEGG IDbpd:BURPS668_A0792
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-11, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|126442544|ref|YP_001061791.1| hypothetical protein BURPS668_A0792 [Burkholderia pseudomallei 668]
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMRAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|126442307|ref|NC_009075.1|:761294-761725 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGG
CCGACCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGCTGAACTTCGGTTGTCCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCATATCTGCGAGGTGATTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGG
TGGTCAAGCCGCGCACGGAGAGCCGCAAGCGCCTCGCGCAGACGATTTATTTCGACGTGTCGATGAGAGC
GCGCGAAGACGGAGCCGAACTCAGGGCGAGCCTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCG
GACGACCGATGA