SecReT6
Protein ID: 126442545
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2127
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2061377..2063119 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3NLA0
KEGG IDbpd:BURPS668_A2127
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-160, Aligned region: 7..580
Protein Sequence: 580 a.a.     [Download]
>gi|126442545|ref|YP_001063121.1| hypothetical protein BURPS668_A2127 [Burkholderia pseudomallei 668]
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDEGLPELV
QALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCR
FVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCA
LGARALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPD
WLPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHY
VPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGDADHLKRMLALHAFGERGDDARAQAD
RRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEID
ASPDGVRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2061377-2063119 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGCCACCACCACGCCCAATCGCTATTACGAGGACGAGCTCGTCCGCCTGCGCGAGCTCGCCGCCGAGT
TCGCCCGCGCGCACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAAAAGCTCGACGAAGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGCTGTTTCCGCACTCGCTGCGCCCGGTGCCGGCGGCCACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCAGTGATCGCGGCCGGCACCGAGATCGAATCGGTGCCCGTCGA
CGGCACCGCCTGCCGGTTTCGCACGTGCGGCGAGCTCGACATCGAGCCGATCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGCACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGCCTCGACGCGAGCG
AATGGGACGCGACGCGCATTCGCCTGTTCATCGGCGGCGAGCGGCTGCACGCAAGCCGCCTGTTCGCGCT
GCTGATGCAGCACGTCGTAGCGGTCGAGATCGCGGGCGGCCCGCCCGAGCTGCCCGGCCCGCGCTGCGCG
CTCGGCGCCCGCGCGCTGCGCCCGGCGGGCTTCGACGACGCGCTGCTGCCCTGCCCCGAGCGGGCGTTCC
CCGGCTTCCGGCTGCTGCACGAATATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGGGCGGCCT
CGAGCGCTGGCGCGCGGCGCGCGCGGGCGCGCAGTTCAGCGTATGGCTCGCGCTCGACAGCGCGCCCGAC
TGGCTGCCCGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCGCCGCGCTGAACCTGTTCGCGCACG
AAGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGATTACCGGCTGCAGCCCGAAGGCGACACGTCGGG
CCACTACCGGATCTACTCGGTCGACCGCGTGATCGGCTACCGCCCCGGCCACGCGGTCGACCGCCATTAC
GTGCCGTTCGGCGTCGCGGGCGACGACGCGAACGCCGCGAGCTATCGGCTGATTCGCCGCGCCGCGCTCG
ACGGCCACGGGCAGGATCTCCATCTGGCGCTCGCCTACCCGCCCGGCGAGGCGCTCGCCACGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCGCGTTGCCCGCGCGCCTGAAGATCGGCGACGTGTGCCGCGCG
ACCGACAGCTCGCCCGAGCGCTTCACGTTCGCCAACATCGCGCCCGTGAGCCCGCCGCTCGATCCGCCGC
TCGGCGAACCGCTGCTGTGGCGCACCATCGGCCATCTCGCGCTGAACTTCCTGTCGCTCGGCGACGCCGA
TCATCTGAAGCGCATGCTCGCGCTCCACGCGTTCGGCGAACGCGGCGACGACGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGGGCCGAGACGCGGATCATCGGCGAGCGGATGC
TGAGCGGCCAGCGCGTGGCGCTGCGCTGCAGCGCCCATGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGATCAACACCTACACGCGCGTCGAGATCGAC
GCGTCGCCCGACGGCGTGCGCTTCGCGTGGCCGCCGCGGATGGGGGCGCAATGCCTGCTCTAG