SecReT6
Protein ID: 126442596
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0170
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]157393..158463 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDA3NFQ5
KEGG IDbpd:BURPS668_A0170
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 184..193
Protein Sequence: 356 a.a.     [Download]
>gi|126442596|ref|YP_001061176.1| ImpA-like N-terminal family protein [Burkholderia pseudomallei 668]
MNATPPAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPRKDAQYGEFVEAPQPANWAEAERDCL
ALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLALLNELLARYGEALHPVPFFEGERDPVVYANAIATLAD
PDATLADIREIPLPKASGLQLQLRDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVA
DLIASTRESLGDDAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGDTD
TQAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIANAIPAELLAQ
WDAIDV
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c158463-157393 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAATGCCACCCCACCCGCCGCCGCGCTGCGCTATGCGGATCTTCTCGAGCCCGTCTCGCCGGACGCAC
CCTGCGGGCCGGACCTCGAATACGATCCGGCGTTCGTGATGCTGCAATCCGCGATCGCGCCGAGGAAAGA
TGCGCAATATGGCGAGTTCGTCGAAGCGCCTCAGCCCGCGAACTGGGCCGAGGCCGAACGCGATTGCCTC
GCGCTGCTGCTGCGCACGAAAGACATCCGGCTCGTCGTGATCCTGATGCGATGCCGAATCCGCCAGAGCG
GCGCGGAGGGCCTGCGCGACGGCCTCGCGCTGCTCAACGAGTTGCTCGCGCGCTACGGTGAGGCGCTGCA
CCCCGTACCGTTCTTCGAAGGCGAACGCGATCCCGTGGTCTATGCGAATGCGATCGCCACGCTGGCGGAC
CCCGATGCGACGCTCGCGGATATTCGGGAAATCCCGTTGCCCAAGGCGAGCGGCCTGCAATTGCAGTTGC
GCGACATCGAAAAGGCGCTCGCGGTGACGCGCGTGAAAGACGCACTCGCGCCCGAATCGGCCAGCCGGCT
GCTGAAGGAATGGTGGAATCGGCGCGACAAGACGATCGCGGCGCTCGCGCAAGCCCAGCGCATCGTGGCC
GATCTGATCGCGTCGACCCGCGAGTCGCTCGGCGACGACGCGCCCGACCTGTCCGGCATCGCGAAACTGC
TGCATCCGTTTGCGCAAGCGCAACTGGAATCGCCGTATTCGGCAAACGCCGCTCAACCGCAAGGCGACGC
GAAGCCGGCGACCGGCGACGCCGCGCATGCGCGCGCCGCCGATACGTCCGCCCAGGCAGGCGATACCGAC
ACGCAAGCGCCCGCTGCGATGCCGATCGCGCCTGCCCAACCGCCGATGGATCGCTGGGGCGCGCTGGCGG
CCATTCAGGCGACGCGCCTTTGGTTCGAGCAAAACGAGCCGAGCAGCCCGGTAATCGTGCTGCTGCGCCA
GTCGGAGCGGATGGTCGGCAAGCGCTTTTCGGAAATCGCCAATGCGATTCCCGCCGAACTGCTCGCGCAA
TGGGATGCGATCGACGTCTAG