SecReT6
Protein ID: 126442634
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2136
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2075946..2077343 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3NLA9
KEGG IDbpd:BURPS668_A2136
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-98, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|126442634|ref|YP_001063130.1| hypothetical protein BURPS668_A2136 [Burkholderia pseudomallei 668]
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRS
YVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAATRYATLPSAEEVADL
HSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRALLERVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVG
ELSVFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRS
AQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2075946-2077343 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGC
GCCCGACGCGCTGCCCGACGCCGCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTG
CATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAAATCGTGTTCGAGCACGAGC
TCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCT
CGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCGCGCTGCTCGAGCGCGTGCGCTGC
ATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCG
CCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGC
GAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGA
AATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCG
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAATGCCGCAGCTCAC
CGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGT
CGCTGCGCTGGGCCGACGCGCCGGACGACCTGCACGCGGAACTCGTCGCAGTGAGGCACACGCAATGA