SecReT6
Protein ID: 126442945
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0796
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]767451..769742 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3NHH4
KEGG IDbpd:BURPS668_A0796
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-71, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 4.50E-71, Aligned region: 691..717
Phage_base_V [PF04717], Evalue: 3.70E-23, Aligned region: 366..459
Protein Sequence: 763 a.a.     [Download]
>gi|126442945|ref|YP_001061795.1| Rhs element Vgr protein [Burkholderia pseudomallei 668]
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTGVSASF
TGLSTSFTGVSTSFTGVSTSFTGVDTSFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSM
TGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMST
TGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|126442307|ref|NC_009075.1|:767451-769742 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCTTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGATCCGGATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAAGGGATTCCGCTCGAGTA
TTACGACTATGCGGCCGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGTTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGCATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGATCGCGCAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGAT
CAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGCTTC
ACGGGCTTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCG
TCGACACCAGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCGATACCAGCTTCAAGGGGGTGTCGAC
TTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTCGGTGACGGGCGTATCGAACAGCATG
ACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACCGGCCAATCCCAAAGCATCACGGGGG
TATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGAC
GAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACG
ACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACCGGCAGCTCGGTGAGCACGACGGGCT
CGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACAGGTTTCAGCTTCTCGTACACCGGCGTCAGCTA
TTCGGACACCGGTATCGACCTGAAGAAGGTCGGCATGCAAGTGAAGAGCTGA