SecReT6
Protein ID: 126442970
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0166
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]148425..151217 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3NFQ1
KEGG IDbpd:BURPS668_A0166
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-78, Aligned region: 41..368
Phage_base_V [PF04717], Evalue: 8.80E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0039, Aligned region: 552..572
Gp5_C [PF06715], Evalue: 0.0039, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0039, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0039, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0039, Aligned region: 618..637
Protein Sequence: 930 a.a.     [Download]
>gi|126442970|ref|YP_001061172.1| Rhs element Vgr protein [Burkholderia pseudomallei 668]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHK
HDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGAN
FSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2793 bp     [Download]
>gi|126442307|ref|NC_009075.1|:148425-151217 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGCACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
CACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTTCCGTTGGCAACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGACGGAATCGGGACGGGCGCGCAAG
GCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTCTGACGAGCGACTACAAG
ATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATATGGCGAAACCGATTTCGACTTCGTTCAGCGTTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGCGGGCATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGGGAAGATCGACATCGAGTACATCAACTATTTCTC
GACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGACTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCG
ACTATACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGGAAGAGCGCCGCGCGACCGGGTC
GCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATACGTTCGTGCTGTCGAAGCACAAG
CACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGCCGTCGAACGAGGTGTTTCGAAT
GCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGACG
CAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGACCGTCCGCTGATTCTCGGCAGC
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGATTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGGACAAGCTGGGGGCCGAGGAATT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGGTCGGCGCGAAT
TTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATGTTCAGCAGCATCGTCGGCGGAG
CCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGCGGCGCGTATGCGTTGAACGTCGGCGG
CGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGGCGCCTACGCGCGCAACGTGGGC
GGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGTGCGTCTTCGATCACCATGACGG
CTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCCCTGCAACTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGGCGGCGGCGGAGGCGGCGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAGCCGATTCTTCCGCCGCCGCCGC
CGCCACCGACGGAGGTGCCACCGGATCCGACGCCGACGCCGACGCCGACGCCGACGCCAACGCCAACGCC
GACGCCGACGCCGACGCCAACGCCAACGCCTACGCCAACGCCAACGCCGACGCCGACGCCGACGCCAACG
CCAACGCCAACGCCAACGCCAACGCCAACGCCTACGCCTACGCCAACGCCTACGCCAACGCCAACGCCGA
CGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCC
AACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCGACGCCGACGCCGACGCCGACGCCGACG
CCCACGCCAACGCCCACACCGACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCGACGCCAA
CGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCGACGCCGACGCCAACGCCAACGCC
AACGCCAACGCCAACGCCAACGCCAACGCCGACGCCAACGCCAACGCCGACGCCGACGCCGACGCCGACG
CCCACGCCGACGCCGACGCCAACACCAACACCAACGCCAACTCCGACTAGTTCCGAGATTTAA